🌐

alicialipfilleracademy.ie

✓ HTTPS ✓ HTTP/2 ⚡ 42766ms
alicialipfilleracademy.ie Overview

Get a snapshot of alicialipfilleracademy.ie's online performance, security posture, and technology profile.

alicialipfilleracademy.ie Website Overview & Technology Report

62
Trust Score
Likely Safe
15
Security
Headers: 1/6
42766ms
Response
Slow
0
Technologies
Detected
🤖 AI Analysis

We performed a comprehensive analysis of alicialipfilleracademy.ie on 2026-07-04. The website returned an HTTP 403 status code with a server response time of 42766ms. The page is served over HTTP/2 protocol, however no compression (Gzip or Brotli) is enabled, which means the page is transferred at its full uncompressed size. The total page weight is 0 KB. The website uses a secure HTTPS connection with a valid SSL certificate issued by Google Trust Services (DV type). The connection is encrypted using TLS 1.3 with the TLS_AES_128_GCM_SHA256 cipher suite and sha256WithRSAEncryption signature algorithm. The certificate covers 2 domain(s) (Subject Alternative Names) and expires on 2026-08-04, which is 31 days from now. The security headers analysis reveals a score of 15/100 (poor). The following security headers are properly configured: Referrer-Policy. However, the site is missing Content-Security-Policy, Strict-Transport-Security (HSTS), X-Frame-Options, X-Content-Type-Options, and Permissions-Policy, which could expose the site and its users to cross-site scripting (XSS), clickjacking, and other web-based attacks. Based on our comprehensive analysis of domain age, SSL configuration, email authentication, security headers, and blacklist status, alicialipfilleracademy.ie receives an overall trust score of 62/100, classified as "Likely Safe".

Status Code403
HTTP VersionHTTP/2
Server
Page Size0 KB
Total Requests0
3rd Party Domains0
SSL CertificateGoogle Trust Services (DV) · 31 days left
TLS VersionTLS 1.3
IP Address185.230.63.171
Categories.IE
alicialipfilleracademy.ie Trust & Safety

Evaluate trustworthiness based on age, SSL, email authentication, security headers, and blacklist status across 8 threat databases.

alicialipfilleracademy.ie Trust Score & Safety Analysis

62
Trust Score
15
Security
🤖 Trust Analysis

After conducting a thorough safety and legitimacy analysis, alicialipfilleracademy.ie receives a trust score of 62/100, which places it in the "Likely Safe" category. This score is calculated by evaluating multiple factors including SSL certificate validity, domain registration history, email authentication protocols, security header configuration, and blacklist status across major threat intelligence databases. The analysis identified several positive trust signals: a valid HTTPS connection protecting data in transit, a valid SSL certificate issued by Google Trust Services with 31 days until expiration, and DNSSEC providing authenticated DNS responses. Areas of concern include: the absence of a Content-Security-Policy header, which leaves the site more vulnerable to cross-site scripting (XSS) attacks, no X-Frame-Options header, which could allow the site to be embedded in malicious iframes (clickjacking), and the domain's WHOIS information is hidden behind a privacy service, making it harder to verify the owner's identity. While these issues don't necessarily indicate malicious intent, they represent areas where the website's security posture could be improved. We checked alicialipfilleracademy.ie against 8 major blacklist databases including Google Safe Browsing, Phishtank, Urlhaus, Openphish, Dnsfilter, Spamhaus Dbl, Surbl, and Virustotal. The domain passed all 8 checks with a clean status, meaning it has not been flagged for phishing, malware distribution, spam, or other malicious activities by any of the tested threat intelligence providers.

HTTPS (no HSTS)
+7
SSL Certificate
+7
Security Headers
−5

Security Headers

Content-Security-Policy✗ Missing
HSTS✗ Missing
X-Frame-Options✗ Missing
X-Content-Type-Options✗ Missing
Referrer-Policy✓ Set
Permissions-Policy✗ Missing

Blacklist Checks 8/8 Clean ✓

Google Safe Browsing
Phishtank
Urlhaus
Openphish
Dnsfilter
Spamhaus Dbl
Surbl
Virustotal

🔍 Analyze Your Own Website

Check your site's trust score, security headers, tech stack and 50+ metrics — completely free.

Analyze Now →
alicialipfilleracademy.ie Technology Stack 0 detected

Discover every technology powering this website — from CMS and frameworks to analytics, payments, and marketing tools.

alicialipfilleracademy.ie Technology Stack & Detected Technologies

🤖 Stack Analysis

Our automated technology detection scan was unable to identify specific technologies on alicialipfilleracademy.ie. This could indicate that the site uses server-side rendering without client-side technology fingerprints, employs aggressive code obfuscation, or uses custom-built solutions that don't match known technology signatures.

alicialipfilleracademy.ie Performance & Web Vitals

Response time, compression, CDN usage, Core Web Vitals, and environmental impact metrics for alicialipfilleracademy.ie.

alicialipfilleracademy.ie Performance & Web Vitals Report

🤖 Performance Analysis

alicialipfilleracademy.ie delivers its homepage in 42766ms (server response time), which is considered slow by industry standards. The total page weight is 0 KB, and we detected 0 resource requests loading assets from 0 third-party domains. A high number of third-party domains can significantly impact page load time due to additional DNS lookups and TLS handshakes required for each domain. No compression is currently enabled on alicialipfilleracademy.ie. Enabling Brotli or Gzip compression could reduce page size by 60-80% for text-based assets (HTML, CSS, JavaScript), significantly improving load times and reducing bandwidth costs. This is one of the simplest and most impactful performance optimizations available. From an environmental perspective, each page view of alicialipfilleracademy.ie produces approximately 0.0g of CO₂, earning a carbon rating of A. This places the website among the cleanest on the web, demonstrating efficient use of server resources and optimized content delivery. For reference, the average web page produces about 0.5g of CO₂ per page view. The page weight of 0 KB is the primary factor in this calculation. Core Web Vitals data from the Chrome User Experience Report (CrUX) is not available for alicialipfilleracademy.ie. This typically means the site doesn't have enough real-world Chrome user traffic to generate statistically significant field data, or the domain is not included in the CrUX dataset. Core Web Vitals (LCP, INP, CLS) are important Google ranking factors that measure real user experience.

Response Time42766ms Slow
Page Size0 KB
CompressionNot detected
CDNNot detected
alicialipfilleracademy.ie DNS & Domain Info

Complete DNS record analysis including email authentication (SPF, DMARC, DKIM), registrar details, and subdomain discovery.

alicialipfilleracademy.ie DNS Records, Email Authentication & Domain Registration

🤖 DNS Analysis

alicialipfilleracademy.ie resolves to the IPv4 address 185.230.63.171, but does not support IPv6. IPv6 adoption is increasingly important as IPv4 address space becomes exhausted, and some ISPs and regions are transitioning to IPv6-only connectivity. The domain has 3 A record(s) configured. The domain name system is managed by 2 name servers: ns4.wixdns.net and ns5.wixdns.net. Having 2 name servers provides good redundancy — if one fails, the others can continue serving DNS queries. The choice of name servers often indicates the DNS hosting provider or CDN service being used. Email for alicialipfilleracademy.ie is handled by alicialipfilleracademy.ie with 1 MX records configured: mail.alicialipfilleracademy.ie. Multiple MX records provide failover redundancy — if the primary mail server is unavailable, email will be routed to the next available server. SPF is not configured, meaning any server could potentially send emails pretending to be from this domain. This is a significant email security concern. DMARC is not configured, leaving the domain vulnerable to email spoofing and phishing attacks that impersonate this domain. DKIM was not detected. Without DKIM, recipients cannot cryptographically verify that emails claiming to be from this domain are authentic. DNSSEC is enabled for alicialipfilleracademy.ie, providing an additional layer of security by cryptographically signing DNS records. This prevents DNS cache poisoning and man-in-the-middle attacks that could redirect visitors to malicious websites.

IP Address185.230.63.171
Nameserversns4.wixdns.net
MX Provideralicialipfilleracademy.ie (mail.alicialipfilleracademy.ie)
SPF✗ Not set
DMARC✗ Not set
DKIM✗ Not found
DNSSEC✓ Enabled
IPv6Not detected
WHOIS Privacy🔒 Private
alicialipfilleracademy.ie Page Analysis

Content structure, media assets, cookie usage, payment methods, and social media presence for alicialipfilleracademy.ie.

alicialipfilleracademy.ie Page Content Analysis

🤖 Content Analysis

The homepage of alicialipfilleracademy.ie contains 17 words of visible text content. This is a relatively short page — adding more descriptive content could improve search engine visibility. The page is structured with 2 H2 headings, 0 H3 headings, 0 H4 headings. The link structure consists of 0 internal links pointing to other pages on the same domain and 0 external links pointing to third-party websites. There are 0 external JavaScript files, 0 CSS stylesheets, and 0 iframes on the page. The site implements the following web standards and features: robots.txt (controls search engine crawling behavior). Notable missing features: XML Sitemap and Schema.org structured data. Adding these could improve search engine discoverability and rich result eligibility.

Word Count17 words
Images0 total · 100% alt coverage
Internal Links0
External Links0
JS Files0
CSS Files0
alicialipfilleracademy.ie SEO & Content Analysis

Evaluate on-page SEO factors including meta tags, Schema.org markup, content metrics, social presence, and environmental impact.

alicialipfilleracademy.ie SEO Analysis, Meta Tags & Content

🤖 SEO Analysis

The title tag for alicialipfilleracademy.ie is good at 13 characters: "403 Forbidden". The length is acceptable, though it may be slightly truncated in some search result displays. No meta description is configured for alicialipfilleracademy.ie. This is a critical SEO oversight — without a meta description, Google will auto-generate a snippet from page content, which may not accurately represent the page or entice users to click. Adding a unique, compelling meta description of 120-155 characters is strongly recommended. No Open Graph tags are configured. When someone shares a link to alicialipfilleracademy.ie on social media, the platform will have to guess the title, description, and image — often producing unattractive or inaccurate previews. Adding OG tags is essential for social media marketing.

Title403 Forbidden
H1Error: Forbidden
Word Count17 words
Images0 total
Internal Links0
External Links0
JS Files0
CSS Files0
Heading StructureH2:2
Redirect Chainhttps://alicialipfilleracademy.iehttps://www.alicialipfilleracademy.ie/
Sitemap✗ Not found
Robots.txt✓ Found
CanonicalNot set
Language
Open GraphNot set
Twitter CardNot set
PWANot detected
RSS FeedNot detected
AMPNot detected

Google SERP Preview

403 Forbidden
https://alicialipfilleracademy.ie

META TAGS & SCHEMA.ORG

META TAGS

Title403 Forbidden
Title Length13 chars Too short
Meta Desc Length0 chars Too short
H1Error: Forbidden
Language
CanonicalNot set
Meta Robots

SCHEMA.ORG & SOCIAL

Schema Types
OG Type
OG ImageNot set
Twitter CardNot set
FaviconNot detected

📊 Compare With Your Competitors

See how your website stacks up against alicialipfilleracademy.ie in trust, speed, security, and technology.

Compare Now →
🛡 Is this your website?

Show visitors your trust score — add a free badge to your site

Trust Score Badge Get Your Badge →