🌐

baltimorejewishlife.com

✓ HTTPS ✓ HTTP/2 Cloudflare ✓ Gzip 60.0% ⚡ 15632ms 🌱 Green
baltimorejewishlife.com Overview

Get a snapshot of baltimorejewishlife.com's online performance, security posture, and technology profile.

baltimorejewishlife.com Website Overview & Technology Report

61
Trust Score
Likely Safe
30
Security
Headers: 2/6
15632ms
Response
Slow
1
Technologies
Detected
🤖 AI Analysis

Baltimorejewishlife.com appears to be a niche website with a focus on Jewish life in Baltimore. With a trust score of 61, it's likely a safe domain to navigate. The response time is relatively fast, taking 15.632 milliseconds. However, the 403 status code indicates that access to the site is restricted, which might be a result of the Cloudflare technology in place.

Status Code403
HTTP VersionHTTP/2
Servercloudflare
Page Size4 KB
Total Requests3
3rd Party Domains1
SSL CertificateGoogle Trust Services
TLS VersionTLS 1.3
IP Address104.26.4.173
baltimorejewishlife.com Trust & Safety

Evaluate trustworthiness based on age, SSL, email authentication, security headers, and blacklist status across 8 threat databases.

baltimorejewishlife.com Trust Score & Safety Analysis

61
Trust Score
30
Security
🤖 Trust Analysis

Our trust score of 61 suggests that Baltimorejewishlife.com has established a level of credibility with its online presence. The website is likely to be run by a reputable organization or individual, and it's probable that it's been around for a while. The SSL issuer, Google Trust Services, adds to the site's trustworthiness, as it's a well-established and trusted certificate authority.

HTTPS (no HSTS)
+7
SPF
+3
SSL Certificate
−10
Security Headers
−5

Security Headers

Content-Security-Policy✗ Missing
HSTS✗ Missing
X-Frame-Options✓ Set
X-Content-Type-Options✗ Missing
Referrer-Policy✓ Set
Permissions-Policy✗ Missing

Blacklist Checks 8/8 Clean ✓

Google Safe Browsing
Phishtank
Urlhaus
Openphish
Dnsfilter
Spamhaus Dbl
Surbl
Virustotal

🔍 Analyze Your Own Website

Check your site's trust score, security headers, tech stack and 50+ metrics — completely free.

Analyze Now →
baltimorejewishlife.com Technology Stack 1 detected

Discover every technology powering this website — from CMS and frameworks to analytics, payments, and marketing tools.

baltimorejewishlife.com Technology Stack & Detected Technologies

🤖 Stack Analysis

Baltimorejewishlife.com is utilizing Cloudflare, a popular content delivery network (CDN) and security solution. This indicates that the site is likely to be optimized for performance, with features such as DNS, load balancing, and SSL encryption. The use of Cloudflare's TLS 1.3 protocol also suggests that the site is committed to maintaining strong security standards.

☁️ CDN
baltimorejewishlife.com Performance & Web Vitals

Response time, compression, CDN usage, Core Web Vitals, and environmental impact metrics for baltimorejewishlife.com.

baltimorejewishlife.com Performance & Web Vitals Report

🤖 Performance Analysis

baltimorejewishlife.com delivers its homepage in 15632ms (server response time), which is considered slow by industry standards. The total page weight is 4 KB, and we detected 3 resource requests loading assets from 1 third-party domains. A high number of third-party domains can significantly impact page load time due to additional DNS lookups and TLS handshakes required for each domain. The website uses Gzip compression for text-based assets, achieving an estimated 60.0% reduction in transfer size. This reduces bandwidth usage and improves page load times, especially for visitors on slower connections. Asset minification status: 0 out of 1 CSS files and 0 out of 0 JavaScript files are minified. Minifying the remaining 1 unminified file(s) could further reduce page weight by 10-30% for those assets. Minification is a best practice that reduces download sizes without affecting functionality. The site is served through a Content Delivery Network (CDN), which caches static assets at edge servers around the world. This means visitors from different geographic regions receive content from the nearest edge server, significantly reducing latency. CDN usage is particularly important for websites with a global audience, as it can reduce page load times by 40-60% for distant visitors. From an environmental perspective, each page view of baltimorejewishlife.com produces approximately 0.0g of CO₂, earning a carbon rating of A. This places the website among the cleanest on the web, demonstrating efficient use of server resources and optimized content delivery. For reference, the average web page produces about 0.5g of CO₂ per page view. The page weight of 4 KB is the primary factor in this calculation. Core Web Vitals data from the Chrome User Experience Report (CrUX) is not available for baltimorejewishlife.com. This typically means the site doesn't have enough real-world Chrome user traffic to generate statistically significant field data, or the domain is not included in the CrUX dataset. Core Web Vitals (LCP, INP, CLS) are important Google ranking factors that measure real user experience.

Response Time15632ms Slow
Page Size4 KB
CompressionGzip 60.0% savings
CDNCloudflare ✓ Active
baltimorejewishlife.com DNS & Domain Info

Complete DNS record analysis including email authentication (SPF, DMARC, DKIM), registrar details, and subdomain discovery.

baltimorejewishlife.com DNS Records, Email Authentication & Domain Registration

🤖 DNS Analysis

The site's infrastructure is likely to be robust, given the presence of Cloudflare. The IP address, 104.26.4.173, is associated with Cloudflare's network, which indicates that the site is hosted on their infrastructure. The MX record, secureserver.net, suggests that the site is using a secure mail server. However, the absence of DMARC and SPF records means that the site is not fully protected against email spoofing and phishing.

IP Address104.26.4.173
IPv62606:4700:20::ac43:4835
Nameserversarya.ns.cloudflare.com
MX Providersecureserver.net (smtp.secureserver.net)
SPF✓ Configured
DMARC✗ Not set
DKIM✗ Not found
DNSSEC✗ Not enabled
IPv6✓ Supported
WHOIS Privacy🔒 Private

Subdomains 9 found

admincdndevftpmailsmtpstagingwebmailwww
baltimorejewishlife.com Page Analysis

Content structure, media assets, cookie usage, payment methods, and social media presence for baltimorejewishlife.com.

baltimorejewishlife.com Page Content Analysis

🤖 Content Analysis

The homepage of baltimorejewishlife.com contains 127 words of visible text content. This is a relatively short page — adding more descriptive content could improve search engine visibility. The page is structured with 3 H2 headings, 0 H3 headings, 0 H4 headings. The link structure consists of 0 internal links pointing to other pages on the same domain and 1 external link pointing to third-party websites. There are 0 external JavaScript files, 1 CSS stylesheets, and 0 iframes on the page. The site implements the following web standards and features: XML Sitemap (helps search engines discover all pages) and robots.txt (controls search engine crawling behavior). Notable missing features: Schema.org structured data. Adding these could improve search engine discoverability and rich result eligibility.

Word Count127 words
Images0 total · 100% alt coverage
Internal Links0
External Links1
JS Files0
CSS Files1
baltimorejewishlife.com SEO & Content Analysis

Evaluate on-page SEO factors including meta tags, Schema.org markup, content metrics, social presence, and environmental impact.

baltimorejewishlife.com SEO Analysis, Meta Tags & Content

🤖 SEO Analysis

The site has a relatively low page size, at 4KB, and a word count of 127. There are no images present on the site. The title, "Attention Required! | Cloudflare," suggests that the site is likely using Cloudflare's reverse proxy technology to improve performance and security. However, the lack of on-page SEO optimization and the limited content may hinder the site's visibility in search engine results pages (SERPs).

TitleAttention Required! | Cloudflare
H1Sorry, you have been blocked
Word Count127 words
Images0 total
Internal Links0
External Links1
JS Files0
CSS Files1
Heading StructureH2:3
Meta Robotsnoindex, nofollow
MinificationJS: 0/0 minified · CSS: 0/1 minified
Sitemap✓ Found
Robots.txt✓ Found
CanonicalNot set
Languageen-US
Open GraphNot set
Twitter CardNot set
PWANot detected
RSS FeedNot detected
AMPNot detected

Google SERP Preview

Attention Required! | Cloudflare
https://baltimorejewishlife.com

META TAGS & SCHEMA.ORG

META TAGS

TitleAttention Required! | Cloudflare
Title Length32 chars Good
Meta Desc Length0 chars Too short
H1Sorry, you have been blocked
Languageen-US
CanonicalNot set
Meta Robotsnoindex, nofollow

SCHEMA.ORG & SOCIAL

Schema Types
OG Type
OG ImageNot set
Twitter CardNot set
FaviconNot detected
baltimorejewishlife.com Deep Intel

Extended intelligence from breach databases, web archives, green hosting verification, and app store presence.

baltimorejewishlife.com Extended Intelligence & Enrichment Data

No Data Breaches Found
baltimorejewishlife.com has not appeared in any known data breach databases.
🌱
Green Hosting Verified
Hosted by Cloudflare — verified eco-friendly infrastructure.

SSL Certificate

IssuerGoogle Trust Services ()
SubjectcommonName=baltimorejewishlife.com
TLSTLS 1.3
CipherTLS_AES_256_GCM_SHA384

📊 Compare With Your Competitors

See how your website stacks up against baltimorejewishlife.com in trust, speed, security, and technology.

Compare Now →
🛡 Is this your website?

Show visitors your trust score — add a free badge to your site

Trust Score Badge Get Your Badge →