🌐

bullhorn.com

WordPress
✓ HTTPS ✓ HTTP/2 ✓ Gzip 60.0% ⚡ 35394ms
bullhorn.com Overview

Get a snapshot of bullhorn.com's online performance, security posture, and technology profile.

bullhorn.com Website Overview & Technology Report

75
Trust Score
Likely Safe
100
Security
Headers: 6/6
35394ms
Response
Slow
6
Technologies
Detected
🤖 AI Analysis

We performed a comprehensive analysis of bullhorn.com on 2026-06-28. The website returned an HTTP 200 status code with a server response time of 35394ms. The page is served over HTTP/2 protocol with Gzip compression enabled, achieving approximately 60.0% size reduction. The total page weight is 191 KB. Warning: The website does not have a valid SSL certificate. Visitors may see security warnings in their browser, and data transmitted to and from this website is not encrypted. The security headers analysis reveals a score of 100/100 (excellent). The following security headers are properly configured: Content-Security-Policy, Strict-Transport-Security (HSTS), X-Frame-Options, X-Content-Type-Options, Referrer-Policy, and Permissions-Policy. All recommended security headers are in place, providing comprehensive protection against common web attacks. Our technology detection scan identified 6 technologies across 6 categories powering bullhorn.com. The detected stack includes WordPress, Salesforce, Marketo, GitHub Pages, Wistia, and jQuery 3.6.0.. Based on our comprehensive analysis of domain age, SSL configuration, email authentication, security headers, and blacklist status, bullhorn.com receives an overall trust score of 75/100, classified as "Likely Safe".

Status Code200 OK
HTTP VersionHTTP/2
ServerPagely-ARES/1.22.2
Page Size191 KB
Total Requests413
3rd Party Domains22
SSL CertificateDigiCert Inc
TLS VersionTLS 1.2
IP Address52.129.16.54
bullhorn.com Trust & Safety

Evaluate trustworthiness based on age, SSL, email authentication, security headers, and blacklist status across 8 threat databases.

bullhorn.com Trust Score & Safety Analysis

75
Trust Score
100
Security
🤖 Trust Analysis

After conducting a thorough safety and legitimacy analysis, bullhorn.com receives a trust score of 75/100, which places it in the "Likely Safe" category. This score is calculated by evaluating multiple factors including SSL certificate validity, domain registration history, email authentication protocols, security header configuration, and blacklist status across major threat intelligence databases. The analysis identified several positive trust signals: a valid HTTPS connection protecting data in transit, HSTS (HTTP Strict Transport Security) enforcement preventing protocol downgrade attacks, SPF (Sender Policy Framework) email authentication preventing email spoofing, DMARC email authentication with a none policy, and DKIM (DomainKeys Identified Mail) providing cryptographic email verification. Areas of concern include: the domain's WHOIS information is hidden behind a privacy service, making it harder to verify the owner's identity and DNSSEC is not enabled, leaving DNS queries vulnerable to spoofing attacks. While these issues don't necessarily indicate malicious intent, they represent areas where the website's security posture could be improved. We checked bullhorn.com against 8 major blacklist databases including Google Safe Browsing, Phishtank, Urlhaus, Openphish, Dnsfilter, Spamhaus Dbl, Surbl, and Virustotal. The domain passed all 8 checks with a clean status, meaning it has not been flagged for phishing, malware distribution, spam, or other malicious activities by any of the tested threat intelligence providers.

HTTPS + HSTS
+12
SPF + DMARC + DKIM
+8
SSL Certificate
−10
Security Headers
+10

Security Headers

Content-Security-Policy✓ Set
HSTS✓ Set
X-Frame-Options✓ Set
X-Content-Type-Options✓ Set
Referrer-Policy✓ Set
Permissions-Policy✓ Set

Blacklist Checks 8/8 Clean ✓

Google Safe Browsing
Phishtank
Urlhaus
Openphish
Dnsfilter
Spamhaus Dbl
Surbl
Virustotal

🔍 Analyze Your Own Website

Check your site's trust score, security headers, tech stack and 50+ metrics — completely free.

Analyze Now →
bullhorn.com Technology Stack 6 detected

Discover every technology powering this website — from CMS and frameworks to analytics, payments, and marketing tools.

bullhorn.com Technology Stack & Detected Technologies

🤖 Stack Analysis

Our technology detection engine scanned bullhorn.com and identified 6 distinct technologies across 6 categories. This analysis is performed by examining HTTP response headers, HTML source code patterns, JavaScript library fingerprints, CSS framework signatures, and DNS records. CMS: WordPress — manages the content and page structure for bullhorn.com. CRM: Salesforce — manages customer relationships and sales pipelines for bullhorn.com. Marketing: Marketo — provides marketing automation capabilities for bullhorn.com. Hosting: GitHub Pages — provides the server infrastructure for bullhorn.com. Video: Wistia — provides video hosting and playback for bullhorn.com. JavaScript Library: jQuery (version 3.6.0.) — provides utility functions and DOM manipulation for bullhorn.com.

• CMS
WordPress 95%
👥 CRM
Salesforce 95%
📣 Marketing
Marketo 95%
🖥️ Hosting
GitHub Pages 95%
🎬 Video
Wistia 95%
📦 JavaScript Library
jQuery 3.6.0. 100%
bullhorn.com Performance & Web Vitals

Response time, compression, CDN usage, Core Web Vitals, and environmental impact metrics for bullhorn.com.

bullhorn.com Performance & Web Vitals Report

🤖 Performance Analysis

bullhorn.com delivers its homepage in 35394ms (server response time), which is considered slow by industry standards. The total page weight is 191 KB, and we detected 413 resource requests loading assets from 22 third-party domains. A high number of third-party domains can significantly impact page load time due to additional DNS lookups and TLS handshakes required for each domain. The website uses Gzip compression for text-based assets, achieving an estimated 60.0% reduction in transfer size. This reduces bandwidth usage and improves page load times, especially for visitors on slower connections. Asset minification status: 2 out of 6 CSS files and 5 out of 9 JavaScript files are minified. Minifying the remaining 8 unminified file(s) could further reduce page weight by 10-30% for those assets. Minification is a best practice that reduces download sizes without affecting functionality. From an environmental perspective, each page view of bullhorn.com produces approximately 0.09g of CO₂, earning a carbon rating of A. This places the website among the cleanest on the web, demonstrating efficient use of server resources and optimized content delivery. For reference, the average web page produces about 0.5g of CO₂ per page view. The page weight of 191 KB is the primary factor in this calculation. Core Web Vitals data from the Chrome User Experience Report (CrUX) is not available for bullhorn.com. This typically means the site doesn't have enough real-world Chrome user traffic to generate statistically significant field data, or the domain is not included in the CrUX dataset. Core Web Vitals (LCP, INP, CLS) are important Google ranking factors that measure real user experience.

Response Time35394ms Slow
Page Size191 KB
CompressionGzip 60.0% savings
CDNNot detected
Carbon / Page View0.09g · Rating A
bullhorn.com DNS & Domain Info

Complete DNS record analysis including email authentication (SPF, DMARC, DKIM), registrar details, and subdomain discovery.

bullhorn.com DNS Records, Email Authentication & Domain Registration

🤖 DNS Analysis

bullhorn.com resolves to the IPv4 address 52.129.16.54, but does not support IPv6. IPv6 adoption is increasingly important as IPv4 address space becomes exhausted, and some ISPs and regions are transitioning to IPv6-only connectivity. The domain has 1 A record(s) configured. The domain name system is managed by 6 name servers: a1-48.akam.net, a11-67.akam.net, a16-64.akam.net, a20-65.akam.net, a22-66.akam.net, and a5-67.akam.net. Having 6 name servers provides good redundancy — if one fails, the others can continue serving DNS queries. The choice of name servers often indicates the DNS hosting provider or CDN service being used. Email for bullhorn.com is handled by mimecast.com with 2 MX records configured: us-smtp-inbound-1.mimecast.com and us-smtp-inbound-2.mimecast.com. Multiple MX records provide failover redundancy — if the primary mail server is unavailable, email will be routed to the next available server. SPF (Sender Policy Framework) is configured, which specifies which mail servers are authorized to send email on behalf of this domain. This helps prevent email spoofing and improves email deliverability. DMARC (Domain-based Message Authentication, Reporting and Conformance) is configured with a none policy — a monitoring-only setting that doesn't enforce any action on unauthorized emails. DKIM (DomainKeys Identified Mail) is configured, adding a cryptographic signature to outgoing emails that receiving servers can verify to confirm the email hasn't been tampered with in transit. DNSSEC is not enabled for bullhorn.com. While not critical for most websites, DNSSEC adds an important security layer by ensuring DNS responses haven't been tampered with during transit. Enabling DNSSEC is recommended for domains handling sensitive data or financial transactions. Our subdomain enumeration scan discovered 12 active subdomains for bullhorn.com: admin.bullhorn.com, api.bullhorn.com, community.bullhorn.com, dev.bullhorn.com, ftp.bullhorn.com, help.bullhorn.com, m.bullhorn.com, and mail.bullhorn.com. Plus 4 additional subdomains. Active subdomains can reveal the organization's infrastructure, including development environments, API endpoints, and third-party service integrations.

IP Address52.129.16.54
Nameserversa1-48.akam.net
MX Providermimecast.com (us-smtp-inbound-1.mimecast.com)
SPF✓ Configured
DMARC✓ none
DMARC Recordv=DMARC1; p=none; rua=mailto:f85afdcb@mxtoolbox.dmarc-report.com,mailto:dmarc@bullhorn.com; ruf=mailto:f85afdcb@forensic
DKIM✓ Found
DNSSEC✗ Not enabled
IPv6Not detected
WHOIS Privacy🔒 Private

Subdomains 12 found

adminapicommunitydevftphelpmmailstagingstatussupportwww

TXT Records / Service Verifications 18

Google ✓ Salesforce ✓ Sendgrid ✓ Atlassian ✓ Apple ✓ Adobe ✓ +12 more
bullhorn.com Page Analysis

Content structure, media assets, cookie usage, payment methods, and social media presence for bullhorn.com.

bullhorn.com Page Content Analysis

🤖 Content Analysis

The homepage of bullhorn.com contains 2,115 words of visible text content. This is a substantial amount of content that provides good opportunities for search engine indexing. The page is structured with 8 H2 headings, 2 H3 headings, 6 H4 headings, 14 H5, and 0 H6 headings. The page includes 123 images. 30 images (24%) are missing alt text attributes, which is a significant concern for both accessibility and SEO. Screen readers rely on alt text to describe images to visually impaired users, and search engines use alt text to understand image content. Only 76% of images have proper alt text — we recommend adding descriptive alt attributes to all images. The link structure consists of 183 internal links pointing to other pages on the same domain and 30 external links pointing to third-party websites. The high number of internal links suggests a well-interconnected site structure, which helps search engines discover and crawl all pages efficiently. There are 9 external JavaScript files, 6 CSS stylesheets, and 1 iframes on the page. The site implements the following web standards and features: XML Sitemap (helps search engines discover all pages), Schema.org structured data (BreadcrumbList, EntryPoint, ImageObject, ListItem, Organization, PropertyValueSpecification, ReadAction, SearchAction, SiteNavigationElement, WebPage, and WebSite), and RSS feed for content syndication. Notable missing features: robots.txt. Adding these could improve search engine discoverability and rich result eligibility. We detected the following payment methods accepted on bullhorn.com: Discover. Offering multiple payment options including credit cards and digital wallets improves customer trust and can increase conversion rates. The website has social media presence across 3 platforms: Facebook (@Bullhorn), Twitter (@Bullhorn), and Linkedin (@bullhorn). An active social media presence is a positive trust indicator and helps build brand awareness and customer engagement.

Word Count2,115 words
Images123 total · 30 missing alt · 76% alt coverage
Internal Links183
External Links30
JS Files9
CSS Files6
Iframes1

Payment Methods

💳 Discover

Social Media Presence 3 platforms

📘 Facebook 𝕏 Twitter 💼 Linkedin
bullhorn.com SEO & Content Analysis

Evaluate on-page SEO factors including meta tags, Schema.org markup, content metrics, social presence, and environmental impact.

bullhorn.com SEO Analysis, Meta Tags & Content

🤖 SEO Analysis

The title tag for bullhorn.com is good at 62 characters: "AI-Powered Online Recruitment Software for Agencies | Bullhorn". The length is acceptable, though it may be slightly truncated in some search result displays. The meta description is 148 characters (well-optimized): "Automate your recruiting lifecycle and increase placements by up to 43% with Bullhorn’s software for recruiters. Explore...". Google typically displays up to 155-160 characters of the meta description in search results. A compelling meta description with a clear call-to-action can significantly improve click-through rates from search results. The canonical url is correctly set to https://www.bullhorn.com/, preventing duplicate content issues, the page language is declared as en-us, the meta robots directive is set to index, follow, max-image-preview:large, max-snippet:-1, max-video-preview:-1, and a favicon is configured. Open Graph meta tags are configured with 4/4 recommended fields: OG title ("AI-Powered Online Recruitment Software for Agencies | Bullho..."), OG description, OG image (social sharing thumbnail), OG type (website). These tags control how the page appears when shared on Facebook, LinkedIn, and other social media platforms that support the Open Graph protocol. A Twitter Card of type summary_large_image is configured, which controls how links appear when shared on Twitter/X. The "summary_large_image" type displays a large image preview, which typically generates higher engagement rates than the basic card type. The site implements Schema.org structured data with the following types: BreadcrumbList, EntryPoint, ImageObject, ListItem, Organization, PropertyValueSpecification, ReadAction, SearchAction, SiteNavigationElement, WebPage, and WebSite. Structured data helps search engines understand the page content and can enable rich results (featured snippets, knowledge panels, star ratings) in Google search results, which can significantly increase click-through rates.

TitleAI-Powered Online Recruitment Software for Agencies | Bullho
H1Meet the pioneers who are reshaping recruitment with Amplify and accelerating re
Word Count2,115 words
Images123 total · 30 missing alt
Internal Links183
External Links30
JS Files9
CSS Files6
Heading StructureH2:8 · H3:2 · H4:6 · H5:14
Iframes1
Meta Robotsindex, follow, max-image-preview:large, max-snippet:-1, max-video-preview:-1
Redirect Chainhttps://bullhorn.comhttp://www.bullhorn.com/https://www.bullhorn.com/
MinificationJS: 5/9 minified · CSS: 2/6 minified
Sitemap✓ Found
Robots.txt✗ Not found
Canonical✓ Set
Languageen-US
Schema.orgBreadcrumbList, EntryPoint, ImageObject, ListItem, Organization, PropertyValueSpecification, ReadAction, SearchAction, SiteNavigationElement, WebPage, WebSite
Open Graph✓ Complete
Twitter Card✓ summary_large_image
PWANot detected
RSS Feed✓ Found
AMPNot detected
Carbon / Visit0.09g · Rating A

Google SERP Preview

AI-Powered Online Recruitment Software for Agencies | Bullho
https://bullhorn.com
Automate your recruiting lifecycle and increase placements by up to 43% with Bullhorn’s software for recruiters. Explore our leading recruiting CRM.

META TAGS & SCHEMA.ORG

META TAGS

TitleAI-Powered Online Recruitment Software for Agencies | Bullho
Title Length62 chars Too long
Meta Desc Length148 chars Good
H1Meet the pioneers who are reshaping recruitment with Amplify and accelerating re
Languageen-US
Canonical✓ Set
Meta Robotsindex, follow, max-image-preview:large, max-snippet:-1, max-video-preview:-1

SCHEMA.ORG & SOCIAL

Schema TypesBreadcrumbList, EntryPoint, ImageObject, ListItem, Organization, PropertyValueSpecification, ReadAction, SearchAction, SiteNavigationElement, WebPage, WebSite
OG Typewebsite
OG Image✓ Set
Twitter Card✓ summary_large_image
Favicon✓ Found

📊 Compare With Your Competitors

See how your website stacks up against bullhorn.com in trust, speed, security, and technology.

Compare Now →