🌐

swipeandwinmytfgrewards.com

✓ HTTPS ✓ HTTP/2 ✓ Gzip 60.0% ⚡ 47247ms
swipeandwinmytfgrewards.com Overview

Get a snapshot of swipeandwinmytfgrewards.com's online performance, security posture, and technology profile.

swipeandwinmytfgrewards.com Website Overview & Technology Report

63
Trust Score
Likely Safe
0
Security
Headers: 0/6
47247ms
Response
Slow
2
Technologies
Detected
🤖 AI Analysis

We performed a comprehensive analysis of swipeandwinmytfgrewards.com on 2026-07-06. The website returned an HTTP 200 status code with a server response time of 47247ms. The page is served over HTTP/2 protocol with Gzip compression enabled, achieving approximately 60.0% size reduction. The total page weight is 15 KB, and the site is served behind a CDN (Content Delivery Network). The website uses a secure HTTPS connection with a valid SSL certificate issued by Let's Encrypt (DV type). The connection is encrypted using TLS 1.3 with the TLS_AES_256_GCM_SHA384 cipher suite and sha256WithRSAEncryption signature algorithm. The certificate covers 5 domain(s) (Subject Alternative Names) and expires on 2026-08-15, which is 40 days from now. The security headers analysis reveals a score of 0/100 (poor). No security headers are configured, which is a significant security concern. However, the site is missing Content-Security-Policy, Strict-Transport-Security (HSTS), X-Frame-Options, X-Content-Type-Options, Referrer-Policy, and Permissions-Policy, which could expose the site and its users to cross-site scripting (XSS), clickjacking, and other web-based attacks. Our technology detection scan identified 2 technologies across 2 categories powering swipeandwinmytfgrewards.com. The detected stack includes Google Analytics 4 and Google Fonts. Based on our comprehensive analysis of domain age, SSL configuration, email authentication, security headers, and blacklist status, swipeandwinmytfgrewards.com receives an overall trust score of 63/100, classified as "Likely Safe".

Status Code200 OK
HTTP VersionHTTP/2
Servercloudflare
Page Size15 KB
Total Requests24
3rd Party Domains3
SSL CertificateLet's Encrypt (DV) · 40 days left
TLS VersionTLS 1.3
IP Address41.204.202.46
swipeandwinmytfgrewards.com Trust & Safety

Evaluate trustworthiness based on age, SSL, email authentication, security headers, and blacklist status across 8 threat databases.

swipeandwinmytfgrewards.com Trust Score & Safety Analysis

63
Trust Score
0
Security
🤖 Trust Analysis

After conducting a thorough safety and legitimacy analysis, swipeandwinmytfgrewards.com receives a trust score of 63/100, which places it in the "Likely Safe" category. This score is calculated by evaluating multiple factors including SSL certificate validity, domain registration history, email authentication protocols, security header configuration, and blacklist status across major threat intelligence databases. The analysis identified several positive trust signals: a valid HTTPS connection protecting data in transit, a valid SSL certificate issued by Let's Encrypt with 40 days until expiration, and SPF (Sender Policy Framework) email authentication preventing email spoofing. Areas of concern include: the absence of a Content-Security-Policy header, which leaves the site more vulnerable to cross-site scripting (XSS) attacks, no X-Frame-Options header, which could allow the site to be embedded in malicious iframes (clickjacking), missing Referrer-Policy, potentially leaking URL information to third parties, the domain's WHOIS information is hidden behind a privacy service, making it harder to verify the owner's identity, and DNSSEC is not enabled, leaving DNS queries vulnerable to spoofing attacks. While these issues don't necessarily indicate malicious intent, they represent areas where the website's security posture could be improved. We checked swipeandwinmytfgrewards.com against 8 major blacklist databases including Google Safe Browsing, Phishtank, Urlhaus, Openphish, Dnsfilter, Spamhaus Dbl, Surbl, and Virustotal. The domain passed all 8 checks with a clean status, meaning it has not been flagged for phishing, malware distribution, spam, or other malicious activities by any of the tested threat intelligence providers.

HTTPS (no HSTS)
+7
SPF
+3
SSL Certificate
+7
Security Headers
−5

Security Headers

Content-Security-Policy✗ Missing
HSTS✗ Missing
X-Frame-Options✗ Missing
X-Content-Type-Options✗ Missing
Referrer-Policy✗ Missing
Permissions-Policy✗ Missing

Blacklist Checks 8/8 Clean ✓

Google Safe Browsing
Phishtank
Urlhaus
Openphish
Dnsfilter
Spamhaus Dbl
Surbl
Virustotal

🔍 Analyze Your Own Website

Check your site's trust score, security headers, tech stack and 50+ metrics — completely free.

Analyze Now →
swipeandwinmytfgrewards.com Technology Stack 2 detected

Discover every technology powering this website — from CMS and frameworks to analytics, payments, and marketing tools.

swipeandwinmytfgrewards.com Technology Stack & Detected Technologies

🤖 Stack Analysis

Our technology detection engine scanned swipeandwinmytfgrewards.com and identified 2 distinct technologies across 2 categories. This analysis is performed by examining HTTP response headers, HTML source code patterns, JavaScript library fingerprints, CSS framework signatures, and DNS records. Analytics: Google Analytics 4 — tracks visitor behavior and provides traffic insights for swipeandwinmytfgrewards.com. Fonts: Google Fonts — delivers web fonts for typography for swipeandwinmytfgrewards.com.

📊 Analytics
🔤 Fonts
swipeandwinmytfgrewards.com Performance & Web Vitals

Response time, compression, CDN usage, Core Web Vitals, and environmental impact metrics for swipeandwinmytfgrewards.com.

swipeandwinmytfgrewards.com Performance & Web Vitals Report

🤖 Performance Analysis

swipeandwinmytfgrewards.com delivers its homepage in 47247ms (server response time), which is considered slow by industry standards. The total page weight is 15 KB, and we detected 24 resource requests loading assets from 3 third-party domains. A high number of third-party domains can significantly impact page load time due to additional DNS lookups and TLS handshakes required for each domain. The website uses Gzip compression for text-based assets, achieving an estimated 60.0% reduction in transfer size. This reduces bandwidth usage and improves page load times, especially for visitors on slower connections. Asset minification status: 0 out of 5 CSS files and 0 out of 6 JavaScript files are minified. Minifying the remaining 11 unminified file(s) could further reduce page weight by 10-30% for those assets. Minification is a best practice that reduces download sizes without affecting functionality. The site is served through a Content Delivery Network (CDN), which caches static assets at edge servers around the world. This means visitors from different geographic regions receive content from the nearest edge server, significantly reducing latency. CDN usage is particularly important for websites with a global audience, as it can reduce page load times by 40-60% for distant visitors. From an environmental perspective, each page view of swipeandwinmytfgrewards.com produces approximately 0.01g of CO₂, earning a carbon rating of A. This places the website among the cleanest on the web, demonstrating efficient use of server resources and optimized content delivery. For reference, the average web page produces about 0.5g of CO₂ per page view. The page weight of 15 KB is the primary factor in this calculation. Core Web Vitals data from the Chrome User Experience Report (CrUX) is not available for swipeandwinmytfgrewards.com. This typically means the site doesn't have enough real-world Chrome user traffic to generate statistically significant field data, or the domain is not included in the CrUX dataset. Core Web Vitals (LCP, INP, CLS) are important Google ranking factors that measure real user experience.

Response Time47247ms Slow
Page Size15 KB
CompressionGzip 60.0% savings
CDNNot detected
Carbon / Page View0.01g · Rating A
swipeandwinmytfgrewards.com DNS & Domain Info

Complete DNS record analysis including email authentication (SPF, DMARC, DKIM), registrar details, and subdomain discovery.

swipeandwinmytfgrewards.com DNS Records, Email Authentication & Domain Registration

🤖 DNS Analysis

swipeandwinmytfgrewards.com resolves to the IPv4 address 41.204.202.46, but does not support IPv6. IPv6 adoption is increasingly important as IPv4 address space becomes exhausted, and some ISPs and regions are transitioning to IPv6-only connectivity. The domain has 1 A record(s) configured. The domain name system is managed by 4 name servers: ns1.dns-h.com, ns1.host-h.net, ns2.dns-h.com, and ns2.host-h.net. Having 4 name servers provides good redundancy — if one fails, the others can continue serving DNS queries. The choice of name servers often indicates the DNS hosting provider or CDN service being used. Email for swipeandwinmytfgrewards.com is handled by swipeandwinmytfgrewards.com with 1 MX records configured: mail.swipeandwinmytfgrewards.com. Multiple MX records provide failover redundancy — if the primary mail server is unavailable, email will be routed to the next available server. SPF (Sender Policy Framework) is configured, which specifies which mail servers are authorized to send email on behalf of this domain. This helps prevent email spoofing and improves email deliverability. DMARC is not configured, leaving the domain vulnerable to email spoofing and phishing attacks that impersonate this domain. DKIM was not detected. Without DKIM, recipients cannot cryptographically verify that emails claiming to be from this domain are authentic. DNSSEC is not enabled for swipeandwinmytfgrewards.com. While not critical for most websites, DNSSEC adds an important security layer by ensuring DNS responses haven't been tampered with during transit. Enabling DNSSEC is recommended for domains handling sensitive data or financial transactions.

IP Address41.204.202.46
Nameserversns1.dns-h.com
MX Providerswipeandwinmytfgrewards.com (mail.swipeandwinmytfgrewards.com)
SPF✓ Configured
DMARC✗ Not set
DKIM✗ Not found
DNSSEC✗ Not enabled
IPv6Not detected
WHOIS Privacy🔒 Private
swipeandwinmytfgrewards.com Page Analysis

Content structure, media assets, cookie usage, payment methods, and social media presence for swipeandwinmytfgrewards.com.

swipeandwinmytfgrewards.com Page Content Analysis

🤖 Content Analysis

The homepage of swipeandwinmytfgrewards.com contains 18 words of visible text content. This is a relatively short page — adding more descriptive content could improve search engine visibility. The page is structured with 0 H2 headings, 0 H3 headings, 0 H4 headings. The page includes 6 images. 1 images (17%) are missing alt text attributes, which is a significant concern for both accessibility and SEO. Screen readers rely on alt text to describe images to visually impaired users, and search engines use alt text to understand image content. Only 83% of images have proper alt text — we recommend adding descriptive alt attributes to all images. The link structure consists of 6 internal links pointing to other pages on the same domain and 1 external link pointing to third-party websites. There are 6 external JavaScript files, 5 CSS stylesheets, and 0 iframes on the page. Notable missing features: XML Sitemap, robots.txt, and Schema.org structured data. Adding these could improve search engine discoverability and rich result eligibility.

Word Count18 words
Images6 total · 1 missing alt · 83% alt coverage
Internal Links6
External Links1
JS Files6
CSS Files5
swipeandwinmytfgrewards.com SEO & Content Analysis

Evaluate on-page SEO factors including meta tags, Schema.org markup, content metrics, social presence, and environmental impact.

swipeandwinmytfgrewards.com SEO Analysis, Meta Tags & Content

🤖 SEO Analysis

The title tag for swipeandwinmytfgrewards.com is good at 11 characters: "TFG Rewards". The length is acceptable, though it may be slightly truncated in some search result displays. The meta description is 11 characters (acceptable): "TFG Rewards". Google typically displays up to 155-160 characters of the meta description in search results. A compelling meta description with a clear call-to-action can significantly improve click-through rates from search results. The page language is declared as en. No Open Graph tags are configured. When someone shares a link to swipeandwinmytfgrewards.com on social media, the platform will have to guess the title, description, and image — often producing unattractive or inaccurate previews. Adding OG tags is essential for social media marketing.

TitleTFG Rewards
H1
Word Count18 words
Images6 total · 1 missing alt
Internal Links6
External Links1
JS Files6
CSS Files5
Redirect Chainhttp://swipeandwinmytfgrewards.comhttps://swipeandwinmytfgrewards.com/https://swipeandwintfgrewards.com/
MinificationJS: 0/6 minified · CSS: 0/5 minified
Sitemap✗ Not found
Robots.txt✗ Not found
CanonicalNot set
Languageen
Open GraphNot set
Twitter CardNot set
PWANot detected
RSS FeedNot detected
AMPNot detected
Carbon / Visit0.01g · Rating A

Google SERP Preview

TFG Rewards
https://swipeandwinmytfgrewards.com
TFG Rewards

META TAGS & SCHEMA.ORG

META TAGS

TitleTFG Rewards
Title Length11 chars Too short
Meta Desc Length11 chars Too short
H1
Languageen
CanonicalNot set
Meta Robots

SCHEMA.ORG & SOCIAL

Schema Types
OG Type
OG ImageNot set
Twitter CardNot set
FaviconNot detected

📊 Compare With Your Competitors

See how your website stacks up against swipeandwinmytfgrewards.com in trust, speed, security, and technology.

Compare Now →
🛡 Is this your website?

Show visitors your trust score — add a free badge to your site

Trust Score Badge Get Your Badge →