Get a snapshot of actividadesdeinfantilyprimaria.com's online performance, security posture, and technology profile.
actividadesdeinfantilyprimaria.com Website Overview & Technology Report
We performed a comprehensive analysis of actividadesdeinfantilyprimaria.com on 2026-06-30. The website returned an HTTP 200 status code with a server response time of 7401ms. The page is served over HTTP/2 protocol with Gzip compression enabled, achieving approximately 60.0% size reduction. The total page weight is 94 KB. The website uses a secure HTTPS connection with a valid SSL certificate issued by Soluciones Corporativas IP SL (DV type). The connection is encrypted using TLS 1.3 with the TLS_AES_256_GCM_SHA384 cipher suite and sha256WithRSAEncryption signature algorithm. The certificate covers 2 domain(s) (Subject Alternative Names) and expires on 2026-10-13, which is 105 days from now. The security headers analysis reveals a score of 0/100 (poor). No security headers are configured, which is a significant security concern. However, the site is missing Content-Security-Policy, Strict-Transport-Security (HSTS), X-Frame-Options, X-Content-Type-Options, Referrer-Policy, and Permissions-Policy, which could expose the site and its users to cross-site scripting (XSS), clickjacking, and other web-based attacks. Our technology detection scan identified 5 technologies across 5 categories powering actividadesdeinfantilyprimaria.com. The detected stack includes WordPress, Google Analytics 4, Google AdSense, Google Fonts, and jQuery. Based on our comprehensive analysis of domain age, SSL configuration, email authentication, security headers, and blacklist status, actividadesdeinfantilyprimaria.com receives an overall trust score of 60/100, classified as "Likely Safe".
Evaluate trustworthiness based on age, SSL, email authentication, security headers, and blacklist status across 8 threat databases.
actividadesdeinfantilyprimaria.com Trust Score & Safety Analysis
After conducting a thorough safety and legitimacy analysis, actividadesdeinfantilyprimaria.com receives a trust score of 60/100, which places it in the "Likely Safe" category. This score is calculated by evaluating multiple factors including SSL certificate validity, domain registration history, email authentication protocols, security header configuration, and blacklist status across major threat intelligence databases. The analysis identified several positive trust signals: a valid HTTPS connection protecting data in transit, a valid SSL certificate issued by Soluciones Corporativas IP SL with 105 days until expiration, and a well-established domain registered for over 11.3 years, indicating long-term commitment and legitimacy. Areas of concern include: the absence of a Content-Security-Policy header, which leaves the site more vulnerable to cross-site scripting (XSS) attacks, no X-Frame-Options header, which could allow the site to be embedded in malicious iframes (clickjacking), missing Referrer-Policy, potentially leaking URL information to third parties, the domain's WHOIS information is hidden behind a privacy service, making it harder to verify the owner's identity, and DNSSEC is not enabled, leaving DNS queries vulnerable to spoofing attacks. While these issues don't necessarily indicate malicious intent, they represent areas where the website's security posture could be improved. We checked actividadesdeinfantilyprimaria.com against 8 major blacklist databases including Google Safe Browsing, Phishtank, Urlhaus, Openphish, Dnsfilter, Spamhaus Dbl, Surbl, and Virustotal. The domain passed all 8 checks with a clean status, meaning it has not been flagged for phishing, malware distribution, spam, or other malicious activities by any of the tested threat intelligence providers. The domain is registered through Soluciones Corporativas IP, SL based in ES, with a registration date of 2015-03-19 and expiration date of 2027-03-19.
Security Headers
Blacklist Checks 8/8 Clean ✓
Rankings & Estimates
Discover every technology powering this website — from CMS and frameworks to analytics, payments, and marketing tools.
actividadesdeinfantilyprimaria.com Technology Stack & Detected Technologies
Our technology detection engine scanned actividadesdeinfantilyprimaria.com and identified 5 distinct technologies across 5 categories. This analysis is performed by examining HTTP response headers, HTML source code patterns, JavaScript library fingerprints, CSS framework signatures, and DNS records. CMS: WordPress — manages the content and page structure for actividadesdeinfantilyprimaria.com. Analytics: Google Analytics 4 — tracks visitor behavior and provides traffic insights for actividadesdeinfantilyprimaria.com. Advertising: Google AdSense — handles advertising pixel tracking and conversion measurement for actividadesdeinfantilyprimaria.com. Fonts: Google Fonts — delivers web fonts for typography for actividadesdeinfantilyprimaria.com. JavaScript Library: jQuery — provides utility functions and DOM manipulation for actividadesdeinfantilyprimaria.com. We also extracted the following tracking identifiers: Google Analytics 4 Measurement ID G-QQT4LC79FF. These IDs can be used to identify other websites operated by the same organization.
Tracking IDs Detected
Response time, compression, CDN usage, Core Web Vitals, and environmental impact metrics for actividadesdeinfantilyprimaria.com.
actividadesdeinfantilyprimaria.com Performance & Web Vitals Report
actividadesdeinfantilyprimaria.com delivers its homepage in 7401ms (server response time), which is considered slow by industry standards. The total page weight is 94 KB, and we detected 247 resource requests loading assets from 18 third-party domains. A high number of third-party domains can significantly impact page load time due to additional DNS lookups and TLS handshakes required for each domain. The website uses Gzip compression for text-based assets, achieving an estimated 60.0% reduction in transfer size. This reduces bandwidth usage and improves page load times, especially for visitors on slower connections. Asset minification status: 2 out of 5 CSS files and 3 out of 14 JavaScript files are minified. Minifying the remaining 14 unminified file(s) could further reduce page weight by 10-30% for those assets. Minification is a best practice that reduces download sizes without affecting functionality. From an environmental perspective, each page view of actividadesdeinfantilyprimaria.com produces approximately 0.05g of CO₂, earning a carbon rating of A. This places the website among the cleanest on the web, demonstrating efficient use of server resources and optimized content delivery. For reference, the average web page produces about 0.5g of CO₂ per page view. The page weight of 94 KB is the primary factor in this calculation. Core Web Vitals data from the Chrome User Experience Report (CrUX) is not available for actividadesdeinfantilyprimaria.com. This typically means the site doesn't have enough real-world Chrome user traffic to generate statistically significant field data, or the domain is not included in the CrUX dataset. Core Web Vitals (LCP, INP, CLS) are important Google ranking factors that measure real user experience.
Complete DNS record analysis including email authentication (SPF, DMARC, DKIM), registrar details, and subdomain discovery.
actividadesdeinfantilyprimaria.com DNS Records, Email Authentication & Domain Registration
actividadesdeinfantilyprimaria.com resolves to the IPv4 address 164.132.249.200, but does not support IPv6. IPv6 adoption is increasingly important as IPv4 address space becomes exhausted, and some ISPs and regions are transitioning to IPv6-only connectivity. The domain has 1 A record(s) configured. The domain name system is managed by 2 name servers: ns2.dondominio.com and ns4.dondominio.com. Having 2 name servers provides good redundancy — if one fails, the others can continue serving DNS queries. The choice of name servers often indicates the DNS hosting provider or CDN service being used. SPF is not configured, meaning any server could potentially send emails pretending to be from this domain. This is a significant email security concern. DMARC is not configured, leaving the domain vulnerable to email spoofing and phishing attacks that impersonate this domain. DKIM was not detected. Without DKIM, recipients cannot cryptographically verify that emails claiming to be from this domain are authentic. DNSSEC is not enabled for actividadesdeinfantilyprimaria.com. While not critical for most websites, DNSSEC adds an important security layer by ensuring DNS responses haven't been tampered with during transit. Enabling DNSSEC is recommended for domains handling sensitive data or financial transactions. The domain is registered through Soluciones Corporativas IP, SL (ES). It was first registered on 2015-03-19 and is set to expire on 2027-03-19, making it 11.3 years old. Our subdomain enumeration scan discovered 1 active subdomains for actividadesdeinfantilyprimaria.com: www.actividadesdeinfantilyprimaria.com. Active subdomains can reveal the organization's infrastructure, including development environments, API endpoints, and third-party service integrations.
Subdomains 1 found
Content structure, media assets, cookie usage, payment methods, and social media presence for actividadesdeinfantilyprimaria.com.
actividadesdeinfantilyprimaria.com Page Content Analysis
The homepage of actividadesdeinfantilyprimaria.com contains 1,054 words of visible text content. This is a substantial amount of content that provides good opportunities for search engine indexing. The page is structured with 8 H2 headings, 0 H3 headings, 3 H4 headings. The page includes 16 images. 8 images (50%) are missing alt text attributes, which is a significant concern for both accessibility and SEO. Screen readers rely on alt text to describe images to visually impaired users, and search engines use alt text to understand image content. Only 50% of images have proper alt text — we recommend adding descriptive alt attributes to all images. The link structure consists of 186 internal links pointing to other pages on the same domain and 5 external links pointing to third-party websites. The high number of internal links suggests a well-interconnected site structure, which helps search engines discover and crawl all pages efficiently. There are 14 external JavaScript files, 5 CSS stylesheets, and 0 iframes on the page. The site implements the following web standards and features: Schema.org structured data (BreadcrumbList, CollectionPage, EntryPoint, ImageObject, ListItem, Organization, PropertyValueSpecification, SearchAction, and WebSite) and RSS feed for content syndication. Notable missing features: XML Sitemap and robots.txt. Adding these could improve search engine discoverability and rich result eligibility. The website has social media presence across 2 platforms: Facebook (@actividadesinfantilyprimaria) and Pinterest (@actividadesdeinfantilyprimaria). An active social media presence is a positive trust indicator and helps build brand awareness and customer engagement.
Social Media Presence 2 platforms
Evaluate on-page SEO factors including meta tags, Schema.org markup, content metrics, social presence, and environmental impact.
actividadesdeinfantilyprimaria.com SEO Analysis, Meta Tags & Content
The title tag for actividadesdeinfantilyprimaria.com is too long at 82 characters: "Actividades de infantil y primaria - Recursos para trabajar en infantil y primar...". At 82 characters, the title will likely be truncated in Google search results (recommended: 50-60 characters). Consider shortening it while keeping the most important keywords at the beginning.
The meta description is 45 characters (acceptable): "Recursos para trabajar en infantil y primaria". Google typically displays up to 155-160 characters of the meta description in search results. A compelling meta description with a clear call-to-action can significantly improve click-through rates from search results.
The canonical url is correctly set to https://www.actividadesdeinfantilyprimaria.com/, preventing duplicate content issues, the page language is declared as es, the meta robots directive is set to index, follow, max-image-preview:large, max-snippet:-1, max-video-preview:-1, and a favicon is configured.
Open Graph meta tags are configured with 3/4 recommended fields: OG title ("Actividades de infantil y primaria..."), OG description, OG type (website). These tags control how the page appears when shared on Facebook, LinkedIn, and other social media platforms that support the Open Graph protocol.
A Twitter Card of type summary is configured, which controls how links appear when shared on Twitter/X. The "summary" type displays a large image preview, which typically generates higher engagement rates than the basic card type.
The site implements Schema.org structured data with the following types: BreadcrumbList, CollectionPage, EntryPoint, ImageObject, ListItem, Organization, PropertyValueSpecification, SearchAction, and WebSite. Structured data helps search engines understand the page content and can enable rich results (featured snippets, knowledge panels, star ratings) in Google search results, which can significantly increase click-through rates.
Google SERP Preview
META TAGS & SCHEMA.ORG
META TAGS
SCHEMA.ORG & SOCIAL
Show visitors your trust score — add a free badge to your site