🌐

democracynow.org

US · Online since 27+ years
✓ HTTPS ✓ HTTP/1.1 ✓ Gzip 60.0% ⚡ 30713ms
democracynow.org Overview

Get a snapshot of democracynow.org's online performance, security posture, and technology profile.

democracynow.org Website Overview & Technology Report

71
Trust Score
Likely Safe
30
Security
Headers: 2/6
30713ms
Response
Slow
6
Technologies
Detected
🤖 AI Analysis

We performed a comprehensive analysis of democracynow.org on 2026-06-29. The website returned an HTTP 200 status code with a server response time of 30713ms. The page is served over HTTP/1.1 protocol with Gzip compression enabled, achieving approximately 60.0% size reduction. The total page weight is 161 KB, and the site is served behind a CDN (Content Delivery Network). The website uses a secure HTTPS connection with a valid SSL certificate issued by Sectigo Limited (OV type). The connection is encrypted using TLS 1.2 with the ECDHE-RSA-AES128-GCM-SHA256 cipher suite and sha256WithRSAEncryption signature algorithm. The certificate covers 3 domain(s) (Subject Alternative Names) and expires on 2027-03-14, which is 258 days from now. The security headers analysis reveals a score of 30/100 (below average). The following security headers are properly configured: X-Content-Type-Options and Referrer-Policy. However, the site is missing Content-Security-Policy, Strict-Transport-Security (HSTS), X-Frame-Options, and Permissions-Policy, which could expose the site and its users to cross-site scripting (XSS), clickjacking, and other web-based attacks. Our technology detection scan identified 6 technologies across 6 categories powering democracynow.org. The detected stack includes Webpack, Google Analytics 4, Google Tag Manager, New Relic, reCAPTCHA v3, and Google Fonts. Based on our comprehensive analysis of domain age, SSL configuration, email authentication, security headers, and blacklist status, democracynow.org receives an overall trust score of 71/100, classified as "Likely Safe".

Status Code200 OK
HTTP VersionHTTP/1.1
Servernginx
Page Size161 KB
Total Requests422
3rd Party Domains15
SSL CertificateSectigo Limited (OV) · 258 days left
TLS VersionTLS 1.2
IP Address50.22.149.218
democracynow.org Trust & Safety

Evaluate trustworthiness based on age, SSL, email authentication, security headers, and blacklist status across 8 threat databases.

democracynow.org Trust Score & Safety Analysis

71
Trust Score
30
Security
🤖 Trust Analysis

After conducting a thorough safety and legitimacy analysis, democracynow.org receives a trust score of 71/100, which places it in the "Likely Safe" category. This score is calculated by evaluating multiple factors including SSL certificate validity, domain registration history, email authentication protocols, security header configuration, and blacklist status across major threat intelligence databases. The analysis identified several positive trust signals: a valid HTTPS connection protecting data in transit, a valid SSL certificate issued by Sectigo Limited with 258 days until expiration, SPF (Sender Policy Framework) email authentication preventing email spoofing, DMARC email authentication with a none policy, and a well-established domain registered for over 26.8 years, indicating long-term commitment and legitimacy. Areas of concern include: the absence of a Content-Security-Policy header, which leaves the site more vulnerable to cross-site scripting (XSS) attacks, no X-Frame-Options header, which could allow the site to be embedded in malicious iframes (clickjacking), the domain's WHOIS information is hidden behind a privacy service, making it harder to verify the owner's identity, and DNSSEC is not enabled, leaving DNS queries vulnerable to spoofing attacks. While these issues don't necessarily indicate malicious intent, they represent areas where the website's security posture could be improved. We checked democracynow.org against 8 major blacklist databases including Google Safe Browsing, Phishtank, Urlhaus, Openphish, Dnsfilter, Spamhaus Dbl, Surbl, and Virustotal. The domain passed all 8 checks with a clean status, meaning it has not been flagged for phishing, malware distribution, spam, or other malicious activities by any of the tested threat intelligence providers. The domain is registered through GoDaddy.com, LLC based in US, with a registration date of 1999-09-10 and expiration date of 2026-09-10.

HTTPS (no HSTS)
+7
Domain Age (27 yrs)
+10
SPF + DMARC
+6
SSL Certificate
+7
Security Headers
−5

Security Headers

Content-Security-Policy✗ Missing
HSTS✗ Missing
X-Frame-Options✗ Missing
X-Content-Type-Options✓ Set
Referrer-Policy✓ Set
Permissions-Policy✗ Missing

Blacklist Checks 8/8 Clean ✓

Google Safe Browsing
Phishtank
Urlhaus
Openphish
Dnsfilter
Spamhaus Dbl
Surbl
Virustotal

Rankings & Estimates

Tranco Rank#15,391 worldwide

🔍 Analyze Your Own Website

Check your site's trust score, security headers, tech stack and 50+ metrics — completely free.

Analyze Now →
democracynow.org Technology Stack 6 detected

Discover every technology powering this website — from CMS and frameworks to analytics, payments, and marketing tools.

democracynow.org Technology Stack & Detected Technologies

🤖 Stack Analysis

Our technology detection engine scanned democracynow.org and identified 6 distinct technologies across 6 categories. This analysis is performed by examining HTTP response headers, HTML source code patterns, JavaScript library fingerprints, CSS framework signatures, and DNS records. Build Tool: Webpack — bundles and optimizes the JavaScript and CSS assets for democracynow.org. Analytics: Google Analytics 4 — tracks visitor behavior and provides traffic insights for democracynow.org. Tag Manager: Google Tag Manager — manages marketing and analytics tags without code changes for democracynow.org. Monitoring: New Relic — monitors application performance and errors for democracynow.org. Security: reCAPTCHA v3 — provides security features like bot detection and CAPTCHA for democracynow.org. Fonts: Google Fonts — delivers web fonts for typography for democracynow.org. We also extracted the following tracking identifiers: Google Tag Manager container GTM-PSMT33J. These IDs can be used to identify other websites operated by the same organization.

🔨 Build Tool
📊 Analytics
📊 Tag Manager
🛡️ Monitoring
🛡️ Security
🔤 Fonts

Tracking IDs Detected

gtm_idGTM-PSMT33J
democracynow.org Performance & Web Vitals

Response time, compression, CDN usage, Core Web Vitals, and environmental impact metrics for democracynow.org.

democracynow.org Performance & Web Vitals Report

🤖 Performance Analysis

democracynow.org delivers its homepage in 30713ms (server response time), which is considered slow by industry standards. The total page weight is 161 KB, and we detected 422 resource requests loading assets from 15 third-party domains. A high number of third-party domains can significantly impact page load time due to additional DNS lookups and TLS handshakes required for each domain. The website uses Gzip compression for text-based assets, achieving an estimated 60.0% reduction in transfer size. This reduces bandwidth usage and improves page load times, especially for visitors on slower connections. Asset minification status: 0 out of 2 CSS files and 0 out of 1 JavaScript files are minified. Minifying the remaining 3 unminified file(s) could further reduce page weight by 10-30% for those assets. Minification is a best practice that reduces download sizes without affecting functionality. The site is served through a Content Delivery Network (CDN), which caches static assets at edge servers around the world. This means visitors from different geographic regions receive content from the nearest edge server, significantly reducing latency. CDN usage is particularly important for websites with a global audience, as it can reduce page load times by 40-60% for distant visitors. From an environmental perspective, each page view of democracynow.org produces approximately 0.08g of CO₂, earning a carbon rating of A. This places the website among the cleanest on the web, demonstrating efficient use of server resources and optimized content delivery. For reference, the average web page produces about 0.5g of CO₂ per page view. The page weight of 161 KB is the primary factor in this calculation. Core Web Vitals data from the Chrome User Experience Report (CrUX) is not available for democracynow.org. This typically means the site doesn't have enough real-world Chrome user traffic to generate statistically significant field data, or the domain is not included in the CrUX dataset. Core Web Vitals (LCP, INP, CLS) are important Google ranking factors that measure real user experience.

Response Time30713ms Slow
Page Size161 KB
CompressionGzip 60.0% savings
CDNNot detected
Carbon / Page View0.08g · Rating A
democracynow.org DNS & Domain Info

Complete DNS record analysis including email authentication (SPF, DMARC, DKIM), registrar details, and subdomain discovery.

democracynow.org DNS Records, Email Authentication & Domain Registration

🤖 DNS Analysis

democracynow.org resolves to the IPv4 address 50.22.149.218, but does not support IPv6. IPv6 adoption is increasingly important as IPv4 address space becomes exhausted, and some ISPs and regions are transitioning to IPv6-only connectivity. The domain has 3 A record(s) configured. The domain name system is managed by 2 name servers: b.ns.democracynow.org and c.ns.democracynow.org. Having 2 name servers provides good redundancy — if one fails, the others can continue serving DNS queries. The choice of name servers often indicates the DNS hosting provider or CDN service being used. Email for democracynow.org is handled by democracynow.org with 2 MX records configured: mx-01.democracynow.org and mx-02.democracynow.org. Multiple MX records provide failover redundancy — if the primary mail server is unavailable, email will be routed to the next available server. SPF (Sender Policy Framework) is configured, which specifies which mail servers are authorized to send email on behalf of this domain. This helps prevent email spoofing and improves email deliverability. DMARC (Domain-based Message Authentication, Reporting and Conformance) is configured with a none policy — a monitoring-only setting that doesn't enforce any action on unauthorized emails. DKIM was not detected. Without DKIM, recipients cannot cryptographically verify that emails claiming to be from this domain are authentic. DNSSEC is not enabled for democracynow.org. While not critical for most websites, DNSSEC adds an important security layer by ensuring DNS responses haven't been tampered with during transit. Enabling DNSSEC is recommended for domains handling sensitive data or financial transactions. The domain is registered through GoDaddy.com, LLC (US). It was first registered on 1999-09-10 and is set to expire on 2026-09-10, making it 26.8 years old. Our subdomain enumeration scan discovered 10 active subdomains for democracynow.org: admin.democracynow.org, api.democracynow.org, dev.democracynow.org, ftp.democracynow.org, m.democracynow.org, mail.democracynow.org, smtp.democracynow.org, and staging.democracynow.org. Plus 2 additional subdomains. Active subdomains can reveal the organization's infrastructure, including development environments, API endpoints, and third-party service integrations.

IP Address50.22.149.218
ASNAS36351 · IBM Cloud
LocationSeattle, US
Nameserversb.ns.democracynow.org
MX Providerdemocracynow.org (mx-01.democracynow.org)
RegistrarGoDaddy.com, LLC
Registered1999-09-10 (27 yrs)
Expires2026-09-10
CountryUS
SPF✓ Configured
DMARC✓ none
DMARC Recordv=DMARC1; p=none; rua=mailto:dmarc@democracynow.org; ruf=mailto:dmarc@democracynow.org; fo=1
DKIM✗ Not found
DNSSEC✗ Not enabled
IPv6Not detected
WHOIS Privacy🔒 Private

Subdomains 10 found

adminapidevftpmmailsmtpstagingwebmailwww

TXT Records / Service Verifications 7

Facebook ✓ Google ✓ Apple ✓ +4 more
democracynow.org Page Analysis

Content structure, media assets, cookie usage, payment methods, and social media presence for democracynow.org.

democracynow.org Page Content Analysis

🤖 Content Analysis

The homepage of democracynow.org contains 2,323 words of visible text content. This is a substantial amount of content that provides good opportunities for search engine indexing. The page is structured with 1 H2 headings, 31 H3 headings, 3 H4 headings, 35 H5, and 0 H6 headings. The page includes 121 images. 121 images (100%) are missing alt text attributes, which is a significant concern for both accessibility and SEO. Screen readers rely on alt text to describe images to visually impaired users, and search engines use alt text to understand image content. Only 0% of images have proper alt text — we recommend adding descriptive alt attributes to all images. The link structure consists of 255 internal links pointing to other pages on the same domain and 34 external links pointing to third-party websites. The high number of internal links suggests a well-interconnected site structure, which helps search engines discover and crawl all pages efficiently. There are 1 external JavaScript files, 2 CSS stylesheets, and 1 iframes on the page. Notable missing features: XML Sitemap, robots.txt, and Schema.org structured data. Adding these could improve search engine discoverability and rich result eligibility. The website has social media presence across 5 platforms: Facebook (@democracynow), Twitter (@democracynow), Instagram (@democracynow), Tiktok (@democracynow.org), and Github (@newrelic). An active social media presence is a positive trust indicator and helps build brand awareness and customer engagement.

Word Count2,323 words
Images121 total · 121 missing alt
Internal Links255
External Links34
JS Files1
CSS Files2
Iframes1

Social Media Presence 5 platforms

📘 Facebook 𝕏 Twitter 📸 Instagram 🎵 Tiktok 🐙 Github
democracynow.org SEO & Content Analysis

Evaluate on-page SEO factors including meta tags, Schema.org markup, content metrics, social presence, and environmental impact.

democracynow.org SEO Analysis, Meta Tags & Content

🤖 SEO Analysis

The title tag for democracynow.org is well-optimized at 31 characters: "Democracy Now! | Democracy Now!". The length falls within the ideal range for Google search results, ensuring the full title is displayed without truncation. No meta description is configured for democracynow.org. This is a critical SEO oversight — without a meta description, Google will auto-generate a snippet from page content, which may not accurately represent the page or entice users to click. Adding a unique, compelling meta description of 120-155 characters is strongly recommended. The canonical url is correctly set to https://www.democracynow.org/, preventing duplicate content issues and the page language is declared as en. Open Graph meta tags are configured with 4/4 recommended fields: OG title ("Democracy Now!..."), OG description, OG image (social sharing thumbnail), OG type (article). These tags control how the page appears when shared on Facebook, LinkedIn, and other social media platforms that support the Open Graph protocol. A Twitter Card of type summary_large_image is configured, which controls how links appear when shared on Twitter/X. The "summary_large_image" type displays a large image preview, which typically generates higher engagement rates than the basic card type.

TitleDemocracy Now! | Democracy Now!
H1You turn to us for voices you won't hear anywhere else.
Word Count2,323 words
Images121 total · 121 missing alt
Internal Links255
External Links34
JS Files1
CSS Files2
Heading StructureH2:1 · H3:31 · H4:3 · H5:35
Iframes1
Redirect Chainhttp://democracynow.orghttps://www.democracynow.org/
MinificationJS: 0/1 minified · CSS: 0/2 minified
Sitemap✗ Not found
Robots.txt✗ Not found
Canonical✓ Set
Languageen
Open Graph✓ Complete
Twitter Card✓ summary_large_image
PWANot detected
RSS FeedNot detected
AMPNot detected
Carbon / Visit0.08g · Rating A

Google SERP Preview

Democracy Now! | Democracy Now!
https://democracynow.org

META TAGS & SCHEMA.ORG

META TAGS

TitleDemocracy Now! | Democracy Now!
Title Length31 chars Good
Meta Desc Length0 chars Too short
H1You turn to us for voices you won't hear anywhere else.
Languageen
Canonical✓ Set
Meta Robots

SCHEMA.ORG & SOCIAL

Schema Types
OG Typearticle
OG Image✓ Set
Twitter Card✓ summary_large_image
FaviconNot detected

📊 Compare With Your Competitors

See how your website stacks up against democracynow.org in trust, speed, security, and technology.

Compare Now →
🛡 Is this your website?

Show visitors your trust score — add a free badge to your site

Trust Score Badge Get Your Badge →