🌐

kalyanimahilapatsanstha.com

WordPress
✓ HTTP/1.1 ⚡ 2232ms
kalyanimahilapatsanstha.com Overview

Get a snapshot of kalyanimahilapatsanstha.com's online performance, security posture, and technology profile.

kalyanimahilapatsanstha.com Website Overview & Technology Report

55
Trust Score
Caution Advised
15
Security
Headers: 1/6
2232ms
Response
Slow
5
Technologies
Detected
🤖 AI Analysis

We performed a comprehensive analysis of kalyanimahilapatsanstha.com on 2026-07-01. The website returned an HTTP 500 status code with a server response time of 2232ms. The page is served over HTTP/1.1 protocol, however no compression (Gzip or Brotli) is enabled, which means the page is transferred at its full uncompressed size. The total page weight is 47 KB. The website uses a secure HTTPS connection with a valid SSL certificate issued by Let's Encrypt (DV type). The connection is encrypted using TLS 1.3 with the TLS_AES_256_GCM_SHA384 cipher suite and sha256WithRSAEncryption signature algorithm. The certificate covers 2 domain(s) (Subject Alternative Names) and expires on 2026-08-14, which is 44 days from now. The security headers analysis reveals a score of 15/100 (poor). The following security headers are properly configured: Referrer-Policy. However, the site is missing Content-Security-Policy, Strict-Transport-Security (HSTS), X-Frame-Options, X-Content-Type-Options, and Permissions-Policy, which could expose the site and its users to cross-site scripting (XSS), clickjacking, and other web-based attacks. Our technology detection scan identified 5 technologies across 5 categories powering kalyanimahilapatsanstha.com. The detected stack includes WordPress 7.0, reCAPTCHA v3, Google Fonts, jQuery, and Font Awesome. Based on our comprehensive analysis of domain age, SSL configuration, email authentication, security headers, and blacklist status, kalyanimahilapatsanstha.com receives an overall trust score of 55/100, classified as "Caution Advised".

Status Code500
HTTP VersionHTTP/1.1
ServerApache
Page Size47 KB
Total Requests106
3rd Party Domains8
SSL CertificateLet's Encrypt (DV) · 44 days left
TLS VersionTLS 1.3
IP Address129.121.72.129
kalyanimahilapatsanstha.com Trust & Safety

Evaluate trustworthiness based on age, SSL, email authentication, security headers, and blacklist status across 8 threat databases.

kalyanimahilapatsanstha.com Trust Score & Safety Analysis

55
Trust Score
15
Security
🤖 Trust Analysis

After conducting a thorough safety and legitimacy analysis, kalyanimahilapatsanstha.com receives a trust score of 55/100, which places it in the "Caution Advised" category. This score is calculated by evaluating multiple factors including SSL certificate validity, domain registration history, email authentication protocols, security header configuration, and blacklist status across major threat intelligence databases. The analysis identified several positive trust signals: a valid SSL certificate issued by Let's Encrypt with 44 days until expiration and SPF (Sender Policy Framework) email authentication preventing email spoofing. Areas of concern include: the absence of a Content-Security-Policy header, which leaves the site more vulnerable to cross-site scripting (XSS) attacks, no X-Frame-Options header, which could allow the site to be embedded in malicious iframes (clickjacking), the domain's WHOIS information is hidden behind a privacy service, making it harder to verify the owner's identity, and DNSSEC is not enabled, leaving DNS queries vulnerable to spoofing attacks. While these issues don't necessarily indicate malicious intent, they represent areas where the website's security posture could be improved. We checked kalyanimahilapatsanstha.com against 8 major blacklist databases including Google Safe Browsing, Phishtank, Urlhaus, Openphish, Dnsfilter, Spamhaus Dbl, Surbl, and Virustotal. The domain passed all 8 checks with a clean status, meaning it has not been flagged for phishing, malware distribution, spam, or other malicious activities by any of the tested threat intelligence providers.

SPF
+3
SSL Certificate
+7
Security Headers
−5

Security Headers

Content-Security-Policy✗ Missing
HSTS✗ Missing
X-Frame-Options✗ Missing
X-Content-Type-Options✗ Missing
Referrer-Policy✓ Set
Permissions-Policy✗ Missing

Blacklist Checks 8/8 Clean ✓

Google Safe Browsing
Phishtank
Urlhaus
Openphish
Dnsfilter
Spamhaus Dbl
Surbl
Virustotal

🔍 Analyze Your Own Website

Check your site's trust score, security headers, tech stack and 50+ metrics — completely free.

Analyze Now →
kalyanimahilapatsanstha.com Technology Stack 5 detected

Discover every technology powering this website — from CMS and frameworks to analytics, payments, and marketing tools.

kalyanimahilapatsanstha.com Technology Stack & Detected Technologies

🤖 Stack Analysis

Our technology detection engine scanned kalyanimahilapatsanstha.com and identified 5 distinct technologies across 5 categories. This analysis is performed by examining HTTP response headers, HTML source code patterns, JavaScript library fingerprints, CSS framework signatures, and DNS records. CMS: WordPress (version 7.0) — manages the content and page structure for kalyanimahilapatsanstha.com. Security: reCAPTCHA v3 — provides security features like bot detection and CAPTCHA for kalyanimahilapatsanstha.com. Fonts: Google Fonts — delivers web fonts for typography for kalyanimahilapatsanstha.com. JavaScript Library: jQuery — provides utility functions and DOM manipulation for kalyanimahilapatsanstha.com. Icon Set: Font Awesome — provides additional functionality for kalyanimahilapatsanstha.com.

• CMS
🛡️ Security
🔤 Fonts
📦 JavaScript Library
🎯 Icon Set
kalyanimahilapatsanstha.com Performance & Web Vitals

Response time, compression, CDN usage, Core Web Vitals, and environmental impact metrics for kalyanimahilapatsanstha.com.

kalyanimahilapatsanstha.com Performance & Web Vitals Report

🤖 Performance Analysis

kalyanimahilapatsanstha.com delivers its homepage in 2232ms (server response time), which is considered slow by industry standards. The total page weight is 47 KB, and we detected 106 resource requests loading assets from 8 third-party domains. A high number of third-party domains can significantly impact page load time due to additional DNS lookups and TLS handshakes required for each domain. No compression is currently enabled on kalyanimahilapatsanstha.com. Enabling Brotli or Gzip compression could reduce page size by 60-80% for text-based assets (HTML, CSS, JavaScript), significantly improving load times and reducing bandwidth costs. This is one of the simplest and most impactful performance optimizations available. Asset minification status: 1 out of 10 CSS files and 2 out of 3 JavaScript files are minified. Minifying the remaining 10 unminified file(s) could further reduce page weight by 10-30% for those assets. Minification is a best practice that reduces download sizes without affecting functionality. From an environmental perspective, each page view of kalyanimahilapatsanstha.com produces approximately 0.02g of CO₂, earning a carbon rating of A. This places the website among the cleanest on the web, demonstrating efficient use of server resources and optimized content delivery. For reference, the average web page produces about 0.5g of CO₂ per page view. The page weight of 47 KB is the primary factor in this calculation. Core Web Vitals data from the Chrome User Experience Report (CrUX) is not available for kalyanimahilapatsanstha.com. This typically means the site doesn't have enough real-world Chrome user traffic to generate statistically significant field data, or the domain is not included in the CrUX dataset. Core Web Vitals (LCP, INP, CLS) are important Google ranking factors that measure real user experience.

Response Time2232ms Slow
Page Size47 KB
CompressionNot detected
CDNNot detected
Carbon / Page View0.02g · Rating A
kalyanimahilapatsanstha.com DNS & Domain Info

Complete DNS record analysis including email authentication (SPF, DMARC, DKIM), registrar details, and subdomain discovery.

kalyanimahilapatsanstha.com DNS Records, Email Authentication & Domain Registration

🤖 DNS Analysis

kalyanimahilapatsanstha.com resolves to the IPv4 address 129.121.72.129, but does not support IPv6. IPv6 adoption is increasingly important as IPv4 address space becomes exhausted, and some ISPs and regions are transitioning to IPv6-only connectivity. The domain has 1 A record(s) configured. The domain name system is managed by 2 name servers: ns1.lbminfotech.net and ns2.lbminfotech.net. Having 2 name servers provides good redundancy — if one fails, the others can continue serving DNS queries. The choice of name servers often indicates the DNS hosting provider or CDN service being used. Email for kalyanimahilapatsanstha.com is handled by kalyanimahilapatsanstha.com with 1 MX records configured: mail.kalyanimahilapatsanstha.com. Multiple MX records provide failover redundancy — if the primary mail server is unavailable, email will be routed to the next available server. SPF (Sender Policy Framework) is configured, which specifies which mail servers are authorized to send email on behalf of this domain. This helps prevent email spoofing and improves email deliverability. DMARC is not configured, leaving the domain vulnerable to email spoofing and phishing attacks that impersonate this domain. DKIM was not detected. Without DKIM, recipients cannot cryptographically verify that emails claiming to be from this domain are authentic. DNSSEC is not enabled for kalyanimahilapatsanstha.com. While not critical for most websites, DNSSEC adds an important security layer by ensuring DNS responses haven't been tampered with during transit. Enabling DNSSEC is recommended for domains handling sensitive data or financial transactions.

IP Address129.121.72.129
Nameserversns1.lbminfotech.net
MX Providerkalyanimahilapatsanstha.com (mail.kalyanimahilapatsanstha.com)
SPF✓ Configured
DMARC✗ Not set
DKIM✗ Not found
DNSSEC✗ Not enabled
IPv6Not detected
WHOIS Privacy🔒 Private
kalyanimahilapatsanstha.com Page Analysis

Content structure, media assets, cookie usage, payment methods, and social media presence for kalyanimahilapatsanstha.com.

kalyanimahilapatsanstha.com Page Content Analysis

🤖 Content Analysis

The homepage of kalyanimahilapatsanstha.com contains 276 words of visible text content. This is a relatively short page — adding more descriptive content could improve search engine visibility. The page is structured with 0 H2 headings, 2 H3 headings, 6 H4 headings. The page includes 21 images. 1 images (5%) are missing alt text attributes, which is a significant concern for both accessibility and SEO. Screen readers rely on alt text to describe images to visually impaired users, and search engines use alt text to understand image content. Only 95% of images have proper alt text — we recommend adding descriptive alt attributes to all images. The link structure consists of 43 internal links pointing to other pages on the same domain and 3 external links pointing to third-party websites. There are 3 external JavaScript files, 10 CSS stylesheets, and 0 iframes on the page. The site implements the following web standards and features: XML Sitemap (helps search engines discover all pages), robots.txt (controls search engine crawling behavior), Schema.org structured data (BreadcrumbList, CollectionPage, ListItem, Organization, and WebSite), and RSS feed for content syndication. The website has social media presence across 2 platforms: Facebook (@Kalyanimahilapatsanstha-433728576829502) and Twitter (@kalyanimahilap1). An active social media presence is a positive trust indicator and helps build brand awareness and customer engagement.

Word Count276 words
Images21 total · 1 missing alt · 95% alt coverage
Internal Links43
External Links3
JS Files3
CSS Files10

Social Media Presence 2 platforms

📘 Facebook 𝕏 Twitter
kalyanimahilapatsanstha.com SEO & Content Analysis

Evaluate on-page SEO factors including meta tags, Schema.org markup, content metrics, social presence, and environmental impact.

kalyanimahilapatsanstha.com SEO Analysis, Meta Tags & Content

🤖 SEO Analysis

The title tag for kalyanimahilapatsanstha.com is too long at 234 characters: "Welcome to Kalyani Mahila nagari sahakari patsanstha ltd. in nashik - We are now...". At 234 characters, the title will likely be truncated in Google search results (recommended: 50-60 characters). Consider shortening it while keeping the most important keywords at the beginning. The meta description is 1125 characters (slightly long): "kalyani mahila nagari sahakari patsanstha ltd. in nashik, kalyani mahila nagari sahakari patsanstha ltd., kalyani mahila...". Google typically displays up to 155-160 characters of the meta description in search results. A compelling meta description with a clear call-to-action can significantly improve click-through rates from search results. The canonical url is correctly set to http://kalyanimahilapatsanstha.com/, preventing duplicate content issues, the page language is declared as en-us, the meta robots directive is set to max-image-preview:large, and a favicon is configured. Open Graph meta tags are configured with 3/4 recommended fields: OG title ("Welcome to Kalyani Mahila nagari sahakari patsanstha ltd. in..."), OG description, OG type (website). These tags control how the page appears when shared on Facebook, LinkedIn, and other social media platforms that support the Open Graph protocol. A Twitter Card of type summary is configured, which controls how links appear when shared on Twitter/X. The "summary" type displays a large image preview, which typically generates higher engagement rates than the basic card type. The site implements Schema.org structured data with the following types: BreadcrumbList, CollectionPage, ListItem, Organization, and WebSite. Structured data helps search engines understand the page content and can enable rich results (featured snippets, knowledge panels, star ratings) in Google search results, which can significantly increase click-through rates. The meta keywords tag contains 47 terms including kalyani mahila nagari sahakari patsanstha ltd. in nashik, kalyani mahila nagari sahakari patsanstha ltd., kalyani mahila, sahakari patsanstha, and mrs. madhavi burkule. Note: Google has officially confirmed that it does not use the meta keywords tag as a ranking signal. However, some other search engines (Bing, Yandex) may still reference it.

TitleWelcome to Kalyani Mahila nagari sahakari patsanstha ltd. in
H1Menu
Word Count276 words
Images21 total · 1 missing alt
Internal Links43
External Links3
JS Files3
CSS Files10
Heading StructureH3:2 · H4:6
Meta Robotsmax-image-preview:large
MinificationJS: 2/3 minified · CSS: 1/10 minified
Sitemap✓ Found
Robots.txt✓ Found
Canonical✓ Set
Languageen-US
Schema.orgBreadcrumbList, CollectionPage, ListItem, Organization, WebSite
Open Graph✓ Complete
Twitter Card✓ summary
PWANot detected
RSS Feed✓ Found
AMPNot detected
Carbon / Visit0.02g · Rating A

Google SERP Preview

Welcome to Kalyani Mahila nagari sahakari patsanstha ltd. in
https://kalyanimahilapatsanstha.com
kalyani mahila nagari sahakari patsanstha ltd. in nashik, kalyani mahila nagari sahakari patsanstha ltd., kalyani mahila, sahakari patsanstha, mrs. madhavi burk

META TAGS & SCHEMA.ORG

META TAGS

TitleWelcome to Kalyani Mahila nagari sahakari patsanstha ltd. in
Title Length234 chars Too long
Meta Desc Length1125 chars Too long
H1Menu
Languageen-US
Canonical✓ Set
Meta Robotsmax-image-preview:large

SCHEMA.ORG & SOCIAL

Schema TypesBreadcrumbList, CollectionPage, ListItem, Organization, WebSite
OG Typewebsite
OG ImageNot set
Twitter Card✓ summary
Favicon✓ Found

📊 Compare With Your Competitors

See how your website stacks up against kalyanimahilapatsanstha.com in trust, speed, security, and technology.

Compare Now →
🛡 Is this your website?

Show visitors your trust score — add a free badge to your site

Trust Score Badge Get Your Badge →