Get a snapshot of teegalavenkateshwaraswamydevasthanam.com's online performance, security posture, and technology profile.
teegalavenkateshwaraswamydevasthanam.com Website Overview & Technology Report
We performed a comprehensive analysis of teegalavenkateshwaraswamydevasthanam.com on 2026-07-06. The website returned an HTTP 200 status code with a server response time of 8033ms. The page is served over HTTP/1.1 protocol, however no compression (Gzip or Brotli) is enabled, which means the page is transferred at its full uncompressed size. The total page weight is 39 KB. The website uses a secure HTTPS connection with a valid SSL certificate issued by Let's Encrypt (DV type). The connection is encrypted using TLS 1.2 with the ECDHE-RSA-AES128-GCM-SHA256 cipher suite and sha256WithRSAEncryption signature algorithm. The certificate covers 2 domain(s) (Subject Alternative Names) and expires on 2026-08-14, which is 39 days from now. The security headers analysis reveals a score of 0/100 (poor). No security headers are configured, which is a significant security concern. However, the site is missing Content-Security-Policy, Strict-Transport-Security (HSTS), X-Frame-Options, X-Content-Type-Options, Referrer-Policy, and Permissions-Policy, which could expose the site and its users to cross-site scripting (XSS), clickjacking, and other web-based attacks. Our technology detection scan identified 1 technologies across 1 categories powering teegalavenkateshwaraswamydevasthanam.com. The detected stack includes WordPress 7.0. Based on our comprehensive analysis of domain age, SSL configuration, email authentication, security headers, and blacklist status, teegalavenkateshwaraswamydevasthanam.com receives an overall trust score of 66/100, classified as "Likely Safe".
Evaluate trustworthiness based on age, SSL, email authentication, security headers, and blacklist status across 8 threat databases.
teegalavenkateshwaraswamydevasthanam.com Trust Score & Safety Analysis
After conducting a thorough safety and legitimacy analysis, teegalavenkateshwaraswamydevasthanam.com receives a trust score of 66/100, which places it in the "Likely Safe" category. This score is calculated by evaluating multiple factors including SSL certificate validity, domain registration history, email authentication protocols, security header configuration, and blacklist status across major threat intelligence databases. The analysis identified several positive trust signals: a valid HTTPS connection protecting data in transit, a valid SSL certificate issued by Let's Encrypt with 39 days until expiration, SPF (Sender Policy Framework) email authentication preventing email spoofing, and DMARC email authentication with a none policy. Areas of concern include: the absence of a Content-Security-Policy header, which leaves the site more vulnerable to cross-site scripting (XSS) attacks, no X-Frame-Options header, which could allow the site to be embedded in malicious iframes (clickjacking), missing Referrer-Policy, potentially leaking URL information to third parties, the domain's WHOIS information is hidden behind a privacy service, making it harder to verify the owner's identity, and DNSSEC is not enabled, leaving DNS queries vulnerable to spoofing attacks. While these issues don't necessarily indicate malicious intent, they represent areas where the website's security posture could be improved. We checked teegalavenkateshwaraswamydevasthanam.com against 8 major blacklist databases including Google Safe Browsing, Phishtank, Urlhaus, Openphish, Dnsfilter, Spamhaus Dbl, Surbl, and Virustotal. The domain passed all 8 checks with a clean status, meaning it has not been flagged for phishing, malware distribution, spam, or other malicious activities by any of the tested threat intelligence providers.
Security Headers
Blacklist Checks 8/8 Clean ✓
Discover every technology powering this website — from CMS and frameworks to analytics, payments, and marketing tools.
teegalavenkateshwaraswamydevasthanam.com Technology Stack & Detected Technologies
Our technology detection engine scanned teegalavenkateshwaraswamydevasthanam.com and identified 1 distinct technologies across 1 categories. This analysis is performed by examining HTTP response headers, HTML source code patterns, JavaScript library fingerprints, CSS framework signatures, and DNS records. CMS: WordPress (version 7.0) — manages the content and page structure for teegalavenkateshwaraswamydevasthanam.com.
Response time, compression, CDN usage, Core Web Vitals, and environmental impact metrics for teegalavenkateshwaraswamydevasthanam.com.
teegalavenkateshwaraswamydevasthanam.com Performance & Web Vitals Report
teegalavenkateshwaraswamydevasthanam.com delivers its homepage in 8033ms (server response time), which is considered slow by industry standards. The total page weight is 39 KB, and we detected 47 resource requests loading assets from 3 third-party domains. A high number of third-party domains can significantly impact page load time due to additional DNS lookups and TLS handshakes required for each domain. No compression is currently enabled on teegalavenkateshwaraswamydevasthanam.com. Enabling Brotli or Gzip compression could reduce page size by 60-80% for text-based assets (HTML, CSS, JavaScript), significantly improving load times and reducing bandwidth costs. This is one of the simplest and most impactful performance optimizations available. Asset minification status: 1 out of 3 CSS files and 0 out of 2 JavaScript files are minified. Minifying the remaining 4 unminified file(s) could further reduce page weight by 10-30% for those assets. Minification is a best practice that reduces download sizes without affecting functionality. From an environmental perspective, each page view of teegalavenkateshwaraswamydevasthanam.com produces approximately 0.02g of CO₂, earning a carbon rating of A. This places the website among the cleanest on the web, demonstrating efficient use of server resources and optimized content delivery. For reference, the average web page produces about 0.5g of CO₂ per page view. The page weight of 39 KB is the primary factor in this calculation. Core Web Vitals data from the Chrome User Experience Report (CrUX) is not available for teegalavenkateshwaraswamydevasthanam.com. This typically means the site doesn't have enough real-world Chrome user traffic to generate statistically significant field data, or the domain is not included in the CrUX dataset. Core Web Vitals (LCP, INP, CLS) are important Google ranking factors that measure real user experience.
Complete DNS record analysis including email authentication (SPF, DMARC, DKIM), registrar details, and subdomain discovery.
teegalavenkateshwaraswamydevasthanam.com DNS Records, Email Authentication & Domain Registration
teegalavenkateshwaraswamydevasthanam.com resolves to the IPv4 address 103.160.145.156, but does not support IPv6. IPv6 adoption is increasingly important as IPv4 address space becomes exhausted, and some ISPs and regions are transitioning to IPv6-only connectivity. The domain has 1 A record(s) configured. The domain name system is managed by 2 name servers: ns1.teegalavenkateshwaraswamydevasthanam.com and ns2.teegalavenkateshwaraswamydevasthanam.com. Having 2 name servers provides good redundancy — if one fails, the others can continue serving DNS queries. The choice of name servers often indicates the DNS hosting provider or CDN service being used. Email for teegalavenkateshwaraswamydevasthanam.com is handled by teegalavenkateshwaraswamydevasthanam.com with 1 MX records configured: mail.teegalavenkateshwaraswamydevasthanam.com. Multiple MX records provide failover redundancy — if the primary mail server is unavailable, email will be routed to the next available server. SPF (Sender Policy Framework) is configured, which specifies which mail servers are authorized to send email on behalf of this domain. This helps prevent email spoofing and improves email deliverability. DMARC (Domain-based Message Authentication, Reporting and Conformance) is configured with a none policy — a monitoring-only setting that doesn't enforce any action on unauthorized emails. DKIM was not detected. Without DKIM, recipients cannot cryptographically verify that emails claiming to be from this domain are authentic. DNSSEC is not enabled for teegalavenkateshwaraswamydevasthanam.com. While not critical for most websites, DNSSEC adds an important security layer by ensuring DNS responses haven't been tampered with during transit. Enabling DNSSEC is recommended for domains handling sensitive data or financial transactions.
Content structure, media assets, cookie usage, payment methods, and social media presence for teegalavenkateshwaraswamydevasthanam.com.
teegalavenkateshwaraswamydevasthanam.com Page Content Analysis
The homepage of teegalavenkateshwaraswamydevasthanam.com contains 898 words of visible text content. This is a moderate amount of content. The page is structured with 18 H2 headings, 12 H3 headings, 0 H4 headings. The page includes 14 images. 7 images (50%) are missing alt text attributes, which is a significant concern for both accessibility and SEO. Screen readers rely on alt text to describe images to visually impaired users, and search engines use alt text to understand image content. Only 50% of images have proper alt text — we recommend adding descriptive alt attributes to all images. The link structure consists of 6 internal links pointing to other pages on the same domain and 12 external links pointing to third-party websites. There are 2 external JavaScript files, 3 CSS stylesheets, and 0 iframes on the page. The site implements the following web standards and features: robots.txt (controls search engine crawling behavior) and RSS feed for content syndication. Notable missing features: XML Sitemap and Schema.org structured data. Adding these could improve search engine discoverability and rich result eligibility.
Evaluate on-page SEO factors including meta tags, Schema.org markup, content metrics, social presence, and environmental impact.
teegalavenkateshwaraswamydevasthanam.com SEO Analysis, Meta Tags & Content
The title tag for teegalavenkateshwaraswamydevasthanam.com is good at 68 characters: "eegala Venkateshwara Swamy Devasthanam – Just another WordPress site". The length is acceptable, though it may be slightly truncated in some search result displays.
No meta description is configured for teegalavenkateshwaraswamydevasthanam.com. This is a critical SEO oversight — without a meta description, Google will auto-generate a snippet from page content, which may not accurately represent the page or entice users to click. Adding a unique, compelling meta description of 120-155 characters is strongly recommended.
The canonical url is correctly set to https://teegalavenkateshwaraswamydevasthanam.com/, preventing duplicate content issues, the page language is declared as en-us, and the meta robots directive is set to max-image-preview:large.
No Open Graph tags are configured. When someone shares a link to teegalavenkateshwaraswamydevasthanam.com on social media, the platform will have to guess the title, description, and image — often producing unattractive or inaccurate previews. Adding OG tags is essential for social media marketing.
Google SERP Preview
META TAGS & SCHEMA.ORG
META TAGS
SCHEMA.ORG & SOCIAL
📂 Browse by Category
Show visitors your trust score — add a free badge to your site