🌐

windshieldreplacementelkgrove.com

WordPress
✓ HTTPS ✓ HTTP/2 ✓ Gzip 60.0% ⚡ 25820ms
windshieldreplacementelkgrove.com Overview

Get a snapshot of windshieldreplacementelkgrove.com's online performance, security posture, and technology profile.

windshieldreplacementelkgrove.com Website Overview & Technology Report

63
Trust Score
Likely Safe
0
Security
Headers: 0/6
25820ms
Response
Slow
7
Technologies
Detected
🤖 AI Analysis

We performed a comprehensive analysis of windshieldreplacementelkgrove.com on 2026-07-05. The website returned an HTTP 200 status code with a server response time of 25820ms. The page is served over HTTP/2 protocol with Gzip compression enabled, achieving approximately 60.0% size reduction. The total page weight is 310 KB. The website uses a secure HTTPS connection with a valid SSL certificate issued by Let's Encrypt (DV type). The connection is encrypted using TLS 1.3 with the TLS_AES_256_GCM_SHA384 cipher suite and sha256WithRSAEncryption signature algorithm. The certificate covers 10 domain(s) (Subject Alternative Names) and expires on 2026-10-01, which is 88 days from now. The security headers analysis reveals a score of 0/100 (poor). No security headers are configured, which is a significant security concern. However, the site is missing Content-Security-Policy, Strict-Transport-Security (HSTS), X-Frame-Options, X-Content-Type-Options, Referrer-Policy, and Permissions-Policy, which could expose the site and its users to cross-site scripting (XSS), clickjacking, and other web-based attacks. Our technology detection scan identified 7 technologies across 7 categories powering windshieldreplacementelkgrove.com. The detected stack includes WordPress 7.0, reCAPTCHA v3, Google Fonts, YouTube Embed, jQuery, Font Awesome, and NitroPack. Based on our comprehensive analysis of domain age, SSL configuration, email authentication, security headers, and blacklist status, windshieldreplacementelkgrove.com receives an overall trust score of 63/100, classified as "Likely Safe".

Status Code200 OK
HTTP VersionHTTP/2
ServerLiteSpeed
Page Size310 KB
Total Requests222
3rd Party Domains20
SSL CertificateLet's Encrypt (DV) · 88 days left
TLS VersionTLS 1.3
IP Address69.72.136.203
windshieldreplacementelkgrove.com Trust & Safety

Evaluate trustworthiness based on age, SSL, email authentication, security headers, and blacklist status across 8 threat databases.

windshieldreplacementelkgrove.com Trust Score & Safety Analysis

63
Trust Score
0
Security
🤖 Trust Analysis

After conducting a thorough safety and legitimacy analysis, windshieldreplacementelkgrove.com receives a trust score of 63/100, which places it in the "Likely Safe" category. This score is calculated by evaluating multiple factors including SSL certificate validity, domain registration history, email authentication protocols, security header configuration, and blacklist status across major threat intelligence databases. The analysis identified several positive trust signals: a valid HTTPS connection protecting data in transit, a valid SSL certificate issued by Let's Encrypt with 88 days until expiration, and SPF (Sender Policy Framework) email authentication preventing email spoofing. Areas of concern include: the absence of a Content-Security-Policy header, which leaves the site more vulnerable to cross-site scripting (XSS) attacks, no X-Frame-Options header, which could allow the site to be embedded in malicious iframes (clickjacking), missing Referrer-Policy, potentially leaking URL information to third parties, the domain's WHOIS information is hidden behind a privacy service, making it harder to verify the owner's identity, and DNSSEC is not enabled, leaving DNS queries vulnerable to spoofing attacks. While these issues don't necessarily indicate malicious intent, they represent areas where the website's security posture could be improved. We checked windshieldreplacementelkgrove.com against 8 major blacklist databases including Google Safe Browsing, Phishtank, Urlhaus, Openphish, Dnsfilter, Spamhaus Dbl, Surbl, and Virustotal. The domain passed all 8 checks with a clean status, meaning it has not been flagged for phishing, malware distribution, spam, or other malicious activities by any of the tested threat intelligence providers.

HTTPS (no HSTS)
+7
SPF
+3
SSL Certificate
+7
Security Headers
−5

Security Headers

Content-Security-Policy✗ Missing
HSTS✗ Missing
X-Frame-Options✗ Missing
X-Content-Type-Options✗ Missing
Referrer-Policy✗ Missing
Permissions-Policy✗ Missing

Blacklist Checks 8/8 Clean ✓

Google Safe Browsing
Phishtank
Urlhaus
Openphish
Dnsfilter
Spamhaus Dbl
Surbl
Virustotal

🔍 Analyze Your Own Website

Check your site's trust score, security headers, tech stack and 50+ metrics — completely free.

Analyze Now →
windshieldreplacementelkgrove.com Technology Stack 7 detected

Discover every technology powering this website — from CMS and frameworks to analytics, payments, and marketing tools.

windshieldreplacementelkgrove.com Technology Stack & Detected Technologies

🤖 Stack Analysis

Our technology detection engine scanned windshieldreplacementelkgrove.com and identified 7 distinct technologies across 7 categories. This analysis is performed by examining HTTP response headers, HTML source code patterns, JavaScript library fingerprints, CSS framework signatures, and DNS records. CMS: WordPress (version 7.0) — manages the content and page structure for windshieldreplacementelkgrove.com. Security: reCAPTCHA v3 — provides security features like bot detection and CAPTCHA for windshieldreplacementelkgrove.com. Fonts: Google Fonts — delivers web fonts for typography for windshieldreplacementelkgrove.com. Video: YouTube Embed — provides video hosting and playback for windshieldreplacementelkgrove.com. JavaScript Library: jQuery — provides utility functions and DOM manipulation for windshieldreplacementelkgrove.com. Icon Set: Font Awesome — provides additional functionality for windshieldreplacementelkgrove.com. Performance: NitroPack — optimizes page loading speed and performance for windshieldreplacementelkgrove.com.

• CMS
🛡️ Security
🔤 Fonts
🎬 Video
📦 JavaScript Library
🎯 Icon Set
⚡ Performance
windshieldreplacementelkgrove.com Performance & Web Vitals

Response time, compression, CDN usage, Core Web Vitals, and environmental impact metrics for windshieldreplacementelkgrove.com.

windshieldreplacementelkgrove.com Performance & Web Vitals Report

🤖 Performance Analysis

windshieldreplacementelkgrove.com delivers its homepage in 25820ms (server response time), which is considered slow by industry standards. The total page weight is 310 KB, and we detected 222 resource requests loading assets from 20 third-party domains. A high number of third-party domains can significantly impact page load time due to additional DNS lookups and TLS handshakes required for each domain. The website uses Gzip compression for text-based assets, achieving an estimated 60.0% reduction in transfer size. This reduces bandwidth usage and improves page load times, especially for visitors on slower connections. Asset minification status: 8 out of 20 CSS files and 10 out of 18 JavaScript files are minified. Minifying the remaining 20 unminified file(s) could further reduce page weight by 10-30% for those assets. Minification is a best practice that reduces download sizes without affecting functionality. From an environmental perspective, each page view of windshieldreplacementelkgrove.com produces approximately 0.15g of CO₂, earning a carbon rating of A. This places the website among the cleanest on the web, demonstrating efficient use of server resources and optimized content delivery. For reference, the average web page produces about 0.5g of CO₂ per page view. The page weight of 310 KB is the primary factor in this calculation. Core Web Vitals data from the Chrome User Experience Report (CrUX) is not available for windshieldreplacementelkgrove.com. This typically means the site doesn't have enough real-world Chrome user traffic to generate statistically significant field data, or the domain is not included in the CrUX dataset. Core Web Vitals (LCP, INP, CLS) are important Google ranking factors that measure real user experience.

Response Time25820ms Slow
Page Size310 KB
CompressionGzip 60.0% savings
CDNNot detected
Carbon / Page View0.15g · Rating A
windshieldreplacementelkgrove.com DNS & Domain Info

Complete DNS record analysis including email authentication (SPF, DMARC, DKIM), registrar details, and subdomain discovery.

windshieldreplacementelkgrove.com DNS Records, Email Authentication & Domain Registration

🤖 DNS Analysis

windshieldreplacementelkgrove.com resolves to the IPv4 address 69.72.136.203, but does not support IPv6. IPv6 adoption is increasingly important as IPv4 address space becomes exhausted, and some ISPs and regions are transitioning to IPv6-only connectivity. The domain has 1 A record(s) configured. The domain name system is managed by 4 name servers: ns1.mysecurecloudhost.com, ns2.mysecurecloudhost.com, ns3.mysecurecloudhost.com, and ns4.mysecurecloudhost.com. Having 4 name servers provides good redundancy — if one fails, the others can continue serving DNS queries. The choice of name servers often indicates the DNS hosting provider or CDN service being used. Email for windshieldreplacementelkgrove.com is handled by windshieldreplacementelkgrove.com with 1 MX records configured: mail.windshieldreplacementelkgrove.com. Multiple MX records provide failover redundancy — if the primary mail server is unavailable, email will be routed to the next available server. SPF (Sender Policy Framework) is configured, which specifies which mail servers are authorized to send email on behalf of this domain. This helps prevent email spoofing and improves email deliverability. DMARC is not configured, leaving the domain vulnerable to email spoofing and phishing attacks that impersonate this domain. DKIM was not detected. Without DKIM, recipients cannot cryptographically verify that emails claiming to be from this domain are authentic. DNSSEC is not enabled for windshieldreplacementelkgrove.com. While not critical for most websites, DNSSEC adds an important security layer by ensuring DNS responses haven't been tampered with during transit. Enabling DNSSEC is recommended for domains handling sensitive data or financial transactions.

IP Address69.72.136.203
Nameserversns1.mysecurecloudhost.com
MX Providerwindshieldreplacementelkgrove.com (mail.windshieldreplacementelkgrove.com)
SPF✓ Configured
DMARC✗ Not set
DKIM✗ Not found
DNSSEC✗ Not enabled
IPv6Not detected
WHOIS Privacy🔒 Private
windshieldreplacementelkgrove.com Page Analysis

Content structure, media assets, cookie usage, payment methods, and social media presence for windshieldreplacementelkgrove.com.

windshieldreplacementelkgrove.com Page Content Analysis

🤖 Content Analysis

The homepage of windshieldreplacementelkgrove.com contains 2,875 words of visible text content. This is a substantial amount of content that provides good opportunities for search engine indexing. The page is structured with 19 H2 headings, 13 H3 headings, 1 H4 headings. The page includes 32 images. 21 images (66%) are missing alt text attributes, which is a significant concern for both accessibility and SEO. Screen readers rely on alt text to describe images to visually impaired users, and search engines use alt text to understand image content. Only 34% of images have proper alt text — we recommend adding descriptive alt attributes to all images. The link structure consists of 117 internal links pointing to other pages on the same domain and 18 external links pointing to third-party websites. The high number of internal links suggests a well-interconnected site structure, which helps search engines discover and crawl all pages efficiently. There are 18 external JavaScript files, 20 CSS stylesheets, and 2 iframes on the page. The site implements the following web standards and features: XML Sitemap (helps search engines discover all pages), robots.txt (controls search engine crawling behavior), Schema.org structured data (Article, GeoCoordinates, ImageObject, LocalBusiness, OpeningHoursSpecification, Organization, Person, PostalAddress, SearchAction, WebPage, and WebSite), and RSS feed for content syndication. We detected the following payment methods accepted on windshieldreplacementelkgrove.com: American Express. Offering multiple payment options including credit cards and digital wallets improves customer trust and can increase conversion rates.

Word Count2,875 words
Images32 total · 21 missing alt · 34% alt coverage
Internal Links117
External Links18
JS Files18
CSS Files20
Iframes2
Cookies1 detected (nitroCachedPage=)

Payment Methods

💳 American Express
windshieldreplacementelkgrove.com SEO & Content Analysis

Evaluate on-page SEO factors including meta tags, Schema.org markup, content metrics, social presence, and environmental impact.

windshieldreplacementelkgrove.com SEO Analysis, Meta Tags & Content

🤖 SEO Analysis

The title tag for windshieldreplacementelkgrove.com is good at 61 characters: "Elk Grove Windshield Replacement | Window Repair | Auto Glass". The length is acceptable, though it may be slightly truncated in some search result displays. The meta description is 169 characters (slightly long): "We specialize in windshield replacement, windshield repair, auto glass replacement, window repair, car window repair, an...". Google typically displays up to 155-160 characters of the meta description in search results. A compelling meta description with a clear call-to-action can significantly improve click-through rates from search results. The canonical url is correctly set to https://windshieldreplacementelkgrove.com/, preventing duplicate content issues, the page language is declared as en-us, the meta robots directive is set to follow, index, max-snippet:-1, max-video-preview:-1, max-image-preview:large, and a favicon is configured. Open Graph meta tags are configured with 4/4 recommended fields: OG title ("Elk Grove Windshield Replacement | Window Repair | Auto Glas..."), OG description, OG image (social sharing thumbnail), OG type (website). These tags control how the page appears when shared on Facebook, LinkedIn, and other social media platforms that support the Open Graph protocol. A Twitter Card of type summary_large_image is configured, which controls how links appear when shared on Twitter/X. The "summary_large_image" type displays a large image preview, which typically generates higher engagement rates than the basic card type. The site implements Schema.org structured data with the following types: Article, GeoCoordinates, ImageObject, LocalBusiness, OpeningHoursSpecification, Organization, Person, PostalAddress, SearchAction, WebPage, and WebSite. Structured data helps search engines understand the page content and can enable rich results (featured snippets, knowledge panels, star ratings) in Google search results, which can significantly increase click-through rates.

TitleElk Grove Windshield Replacement | Window Repair | Auto Glas
H1Elk Grove Auto Glass & Windshield Repair Specialist
Word Count2,875 words
Images32 total · 21 missing alt
Internal Links117
External Links18
JS Files18
CSS Files20
Heading StructureH2:19 · H3:13 · H4:1
Iframes2
Cookies1 detected (nitroCachedPage=)
Meta Robotsfollow, index, max-snippet:-1, max-video-preview:-1, max-image-preview:large
MinificationJS: 10/18 minified · CSS: 8/20 minified
Sitemap✓ Found
Robots.txt✓ Found
Canonical✓ Set
Languageen-US
Schema.orgArticle, GeoCoordinates, ImageObject, LocalBusiness, OpeningHoursSpecification, Organization, Person, PostalAddress, SearchAction, WebPage, WebSite
Open Graph✓ Complete
Twitter Card✓ summary_large_image
PWANot detected
RSS Feed✓ Found
AMPNot detected
Carbon / Visit0.15g · Rating A

Google SERP Preview

Elk Grove Windshield Replacement | Window Repair | Auto Glas
https://windshieldreplacementelkgrove.com
We specialize in windshield replacement, windshield repair, auto glass replacement, window repair, car window repair, and more! We are Chicago leading car windo

META TAGS & SCHEMA.ORG

META TAGS

TitleElk Grove Windshield Replacement | Window Repair | Auto Glas
Title Length61 chars Too long
Meta Desc Length169 chars Too long
H1Elk Grove Auto Glass & Windshield Repair Specialist
Languageen-US
Canonical✓ Set
Meta Robotsfollow, index, max-snippet:-1, max-video-preview:-1, max-image-preview:large

SCHEMA.ORG & SOCIAL

Schema TypesArticle, GeoCoordinates, ImageObject, LocalBusiness, OpeningHoursSpecification, Organization, Person, PostalAddress, SearchAction, WebPage, WebSite
OG Typewebsite
OG Image✓ Set
Twitter Card✓ summary_large_image
Favicon✓ Found

📊 Compare With Your Competitors

See how your website stacks up against windshieldreplacementelkgrove.com in trust, speed, security, and technology.

Compare Now →
🛡 Is this your website?

Show visitors your trust score — add a free badge to your site

Trust Score Badge Get Your Badge →